KEGG   Archangium gephyra: AA314_04050Help
Entry
AA314_04050       CDS       T03948                                 

Definition
(GenBank) Malonyl CoA-acyl carrier protein transacylase
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C ketoacyl-synt Acyl_transf_1 Bac_luciferase Ketoacyl-synt_C Thioesterase KAsynt_C_assoc Thiolase_N DUF2974
Motif
Other DBs
NCBI-ProteinID: AKJ02424
UniProt: A0A0G2ZUH6
LinkDB All DBs
Position
complement(4958532..4984085)
Genome map
AA seq 8517 aa AA seqDB search
MPQPRSLVALLEERSATRSEQRLYTFLEEGDAEGVPLTRGELYTRARRIGAVLQELAPAG
ERAVLLYPPGAEYLTGFFGCLFSGLVAVPAYPPDPSRLERTLPRLRAIIQDSRATVVLTT
SFVLSMAELIFEAAPDLRALRWVATDELTPGAEAGWKRPDVTSDSLAFLQYTSGSTGTPK
GVMLSHANLLHNLELIRGAFQTREDSVGVIWLPPYHDMGLIGGILVPLYQGFHTALMSPL
SFLKRPRAWLEALTRYGGTISGGPNFAFELCVRRIAPEERQGLDLSRWEVAFCGAEPIRS
GMLDRFTEAFAPHGFRREAFYPCYGLAEATLIVSGGAKSEPPLVREVEAIALERGHAVEP
RPGLEARTLVGCGGTLGEQRVAVVDPESLQQLPPGEVGEIWVSGPSVAHGYWQQPEESAA
TFRARTASGEGPFLRTGDLGFLDKGELYVTGRRKDLIILRGRNLYPQDLELTVEQSHPAL
RPGCGAAFGVEVDGEERLVVVQEVDPRKLDGAAEDLVGAIRQRLAEGHEVRPHALVLIEP
GSLPKTSSGKVQRRACRTAFLAGELRVVHASHASEPAARAPSSPSPAPRAASSELEALVL
ARIAARLGAPVESLDPDMPLTRLGLDSLAAVELAHGLEKALGVPLPMETLLSGVSASELA
RELSARKAAAGARPAIPRASRTAFPPLSFAQQRLWFLDRLEPGSAFYNLPVVSRLNGVLD
VPALERSFQALVQRHESLRTVFLEKDGEPYQNILAEQALPLPLVDLSGLPEDAREQEAQR
LSREEAQRPFELSRGPLLRATLLRLGAERHLLLLTLHHIIADGWSMRVLVRELEELHRAF
SAGHTPALDALPLQFADYALWQREWLRGERLEDLVGWWKAHLAGAPAVLELPGDRARPRA
QSYRGAQVVRRLESAAWERVKALARREGTTPFVTLLAGFQLLLHRYTGQEDLVVGVDTAH
RSRPETAGLIGLFVNQLPVRGNLAGAPTFRELLARLHQETLDVWAHQDLPFDELVRGLNP
ERSLAHAPVFQVKLVLQEAVPASLGRSGLSLESTLGDTGATKLDLTLSVTDTAHGLELLC
EYATDLFDASTVSRLLGHLCLLLESAAAAPERRVSELPLLSQEERHLALVEWSRTTPAVP
EDCAHRLFEEQARLTPGATAVSLGESSLTYRELEARANQLAWHLRSLGVGPDVVVGIHLE
RTPELVVAMLGVLKAGGAFLPLDTSYPSARLELMLREARVPVLVSREALADSLGSQGELL
VLLDTERSALALQPETALSPAPAVTPSNLAYIIFTSGSTGTPKGTLLEHHGLCNTARATH
EALGLRPGNRFLQLAAIGFDASVSEIFSTLLCGAELVLAPPESLLPGPPLQQVLAEKAIT
TITATPTSLAPLEPEALPALAVVASVGEACTPELARRWKHGRRFLNFYGPTEATVCATME
RDVEPRQPSIGRAIPGAQTYVLDARLEPVPVGIPGELYVGGAGVARGYLNRPALTAERFV
PNPFATLPGERLYRTGDLVRLLPDGRLEFLGRRDAQVKVRGVRVELGEVEAALGLYPGVR
QVVVVPRESAGEARLVAYVVAGEAMEPAVLRRFLKERLPEVMVPSAFVRLDALPITPGGK
VDRQALPSPDAVSPAPDAPFAEPRSELERRIASVWARVLEVPRVGLHDHFFEDLGGSSLL
VVKASTQLRDELGQTIPVTHLFEHPTVSKLAARLERELPARAPEPAPRPAPSGDDGSHDI
ALIGMAGRFPGAGDVHAFWENLRQGVESISRFAPEELEPSPLFPDSLRDHPDFVPAGGVL
EGADGFDARFFELSPREAQWMDPQQRLFLQCAWHALEDAGYDPERFQGPISLHAGAGTSS
VHLLSLLGQTRKDPASLFEALGTTSGENVATKTAYKLGLSGECLNVYTACSTGLVAVHLA
CQSLRTRQSDLALAGAVKVSLPQRTGYLFQEGMILSPDGHCRAFDASARGTVLGNGLGVV
VLKRLSDALRDGDHVYAVIKGSALNNDASAKVSYTAPSVQGQSEVIARALASAGVDASSI
GYLEAHGTGTSLGDPIEIAALTRAYRAQTERTGYCAIGSVKTNIGHLDTAAGIAGLIKAA
LALHHGELPPSLHFERPNPEIDFEHSPFFVNTAPRTWERGEGPRRAGVSSFGIGGTNAHV
VLEEAPRQGGGGHGSHRTRQLITLSARSASALEAMTHALAGFVATHPEVELADLAFTRNV
GRKSFEYRRALVAEDSAGLLRALRHPGTPSEVRDLEAARSRRVAFLFPGQGAQSVRMAQE
LYTSEPIFRRELDACLALLPRVGLSEDLHPVLFPEPGSEARAEARLAEPRFALPALLSVE
YALARLWMGFGFTPSALLGHSFGEYTAACLSGVLSLEDALRLAVVRGELMSRLPPGGMLG
VGLSASEVAPLLSGELELAALNGPDRCTVSGPVEALEALERQLSARRVGVMRLAAAHAFH
SRAVEPVMAELERAVAGLTLNAPTIPFVSSLTGTWIRPEEATSPRYWARQMREPVRFASG
LDALVDAGCGWFIEAGPDQALTALVKPRLRNAREALVVPSLRRSGTSTSDAQTLLESLGA
LWRAGAAVDWKGFHAHEHRRRIPLPGYPFEEKRISLEERPVLPLPLPAAAPVPAPTAAAT
VPPPAAPVIPEARAPQGDIQQRLTELWRERLGVEDIGPDDSFLDLGGNSLMAAQLLTRLR
ETFRVQIPLSDLFEAPTIAGLAARIEARLQVELPAGEAAAAAMLPVPRTGELPLSYVQER
VWEMELREPGSSIFNEPLAIRISGALRPDLLERGLNEVIRRHESLRTVFAQVDGRATPRI
LSEVRISLPVVDLRGFTGDREAEAMRLARLAPAEPFPLDRGPLVRVQLLRMAEAEYILLV
TIHHIVADTLSLVNFIREAVAFYTGFVHGRPVPLPELPIQYIDFTVWQRRALADGTLSAQ
QAYWRKQLARRPGPLPLPLDRPRAEGARRRGARHSFAFPKALGTALQAFSQREGLTPYMT
LLAGFKALLARCSGQEDILVGTSIGNRTRPELEPQIGYVAHALALRTSLEGDPSFRSLAL
RVRDTTLSAFAQPDVPYEQLLGELEPGEEARLSRLFDAIFLLHTQDVSAPILEFPGLRLS
YFDVTGLPAQYGTSLADLTLLMREDAQGFSGTLEYAVDLFDAATIVRLLSQLEALLTDAV
ASPDKPLSQLSLEGAPERTGGPVTGASEAASLVALLSAQAERAPEAVALRRGDQRLTWRA
LRAHAHALASGLRARGVGPGVPVAVCLEPSPERAVALWGVLASGGAYALVSREHSEELST
LGLDGSSPLLITTASLPLPPRLDESRVIRLTLSGEPPAESFPATVAADSLACLVRETEDG
GRPRLMWSHRNLLHRFAALDARVDTRPGETWLSASDASADPAGVELLWALARGLQVVFPV
QPAARLVVLRPEQAATRQLDFSLFYFANDAEASGRKKYQLLIDGAKFADTHGFSAVWTPE
RHFHAFGGPYPSPTATSAALAMVTERVSLRAGSVVLPLHDPIRVAEEWSVIDNLSDGRAG
VSFATGWNANDFVFAPQNFHQRPEAIRRGVEEVRTLWRGGSVRRTNGTGTEVEISIRPRP
VQEELPIWITAAFNPETFRLAGELGTGLLTNVLGLGQDFEELARKISIYREARRKAGHGR
GHVVLMLHTFVAGSQEDVKRQAREPLIRYFRSSVELFNGLVANQGLGFDVRDLTPQDMEI
LLQQGVSRYLEAGGMFGTPETLAARVEQLRQADVDEVACLIDFGLGHEATMEGLRHLDVL
RRRSQEGQSSAPTTPVLVEADGLRVLAESLRASPPAHLRCTAALARSLARMPDAAEVLGP
VRTLVLDEADGLPADVAESLKRVASARVVAPVSLLPDTKDAASRTSRFVLDAAGRRAPVG
VVGELFLGGDAAPLGFWKAPELTRTRLRASPDGTEARLYGTGTPARYRADGEVEVVTPTA
RRRPAPVEPTPSTPAPVRPAAPAVREGVITRAPRNELPPLSYAQQRLWFLDQYQPGSALY
NMPAAMRLKGTLDVAALGRAFADVIRRHEALHTTFQAREGEAVQIISPDMAWALEVEALG
HLPEPEREAEAMRLASEEASRPFELTRGPLLRARLLRLTAEEHVLLVTMHHIVSDSWSVG
VLIREVVTLYAAFATGRPSPLPELPIQYADYAVWQREWMKGQVLTRQVEYWRKQLEGVPP
ALELSTDWPRTANTRNPGASLRVELPLELTQGLRALCRREKGTLFMGLLAGLQVLLARYT
AQDDICVGAPIAGRNQPQTEALIGFFVNTLVLRGQLHGDPSFLELLRQAREVTLGAYANQ
DVPFEKLVEVLQPPRLPEHTPFFQVALVLLNTPSAELTGPGLTFRPLEVDSGTAKFDFTL
VITETPRGLSTTLEYRSDLFEASTAARMMEHLRLLLEDAVAHPERRISQLSLLSEAERRQ
LMVEWNTTTPEPVRSFCMQELFEAQAARTPDAVAVVFEDSQLTYAQLEHRANQLAHVLHA
RGVRPGVWVAICLERSLEMIVAVLAVLKAGASYVPLDPAYPAERLTFMLEDTGATVLLTQ
EHLRATLPPFSGHVLELDASWRAFSQVSSEPLASGVTPGHPAYIIYTSGSTGTPKGIVMP
HRALSNMLVWQIRQSNLPEANTLQFSSLSFDVSIQEFFTTWATGGTLFVPTAAVRRDIPA
LLAYLVRHRVQRLFVPFVVLQALADAVAHGAPLPSSLRELVTAGEQLQVTPALVALFERL
PGCVLENQYGPSEAHVVTAHRLRGPPASWPRLPPVGSPLPNTPLYVLDAHGQLCPIGVRG
DVYVGGPQLALGYHERPHVTADRFVPNPFSGEPGARLYRTGDHVRWRADGTLEYLGRLDG
QVKVRGFRIEMGEVEAALREAPGVRDATAQVREDAPGDKRLVGYVVLHAGIDWEPEALRQ
SLALRLPEYMVPSALVRLDALPLNPSGKLNRALLPAPDADSLRGAAPFVAPRTPVEQTLA
DTFASVLGLPRLSVTDNFFSMGGHSLLATQIVSRLRSSLGVELPLRAVFEAPTVEALARR
VEAQTGTGENAARKSVVMPRTGLSEGELSFAQQRLWFLDQYQPGTALYNMPAGLRLEGVL
DVGALERAFSELVRRHEVLRTTFQVREGKPVQVIAPASHRALEVTDLGHLPRPEREAEAI
RLAQEDALQPFDLARGPLLRTRLLRLAGNEHLLTMVLHHTISDGWSIAVLIRDMVALYEA
CVTGKPAPLPELPIQYVDYALWQREWLQGEVLEQQLGYWRKQLEGAPPSLELPTDRPRTT
DTSNPGASLNVELPLELIEGLGALCQREGATLYMGLLAGLQAVLARYSGQDDICVGAPIA
GRTQTQTEELVGFFVNTLVMRTRLEGNPSFRELLGRVKDVTLGAYAHQDVPFEKLVEVLQ
PPRQPEHTPFFQVALVLLNTPTAELSVPGLNLRLLDLDTRTSKFDFTLTLRQEGQGLNGV
LEYRSDLFEASTAARMMEHLRLLLEDAVAHPERRLSQLSLMSEAERRQVLVEWNTSTAAP
SRPRCVHELFEAQAARTPDAVAVVFEGSQLTYAQLEHRANQLAHTLSARGVRPGDSVALC
VERSLEMVVAVLAVLKAGAAYVPLDPAYPAERLAFMLEDTGAPVLLTQEHLRATLPPFPG
HLLVLDSTWQAFSQTSPLPRVSGATPEHPAYVIYTSGSTGKPKGVALPHRALSNLLDWQL
KQSVHPAATTLQFASLSFDVSFQELFSTWCAGGTLVVPSAAVRQDMPALLAYVQRQGVQR
LFLPFVALQAFADAVAHGAPLPTSLREVVTAGEQLQVTPALVALFERLPGCVLENQYGPS
ETHVVSAHRLHGPPASWPRLPPIGSPLPLTPLYVLDAQGQPCPVGVRGELFIGGVQLALG
YHARPPLTAEKFVPHPFSEQPGARLYRTGDRARWRADGTLEYLGRLDGQVKVRGFRIEQG
EVEAALREAPGVRDAAALVREDVPGDKRLVGYVVLDPGTSWEPEALRQSLARRLPEYMVP
SALVRLEALPLTPSGKLARRLLPAPDADSLRGAAPFVAPRTPLEQTLADTFTSVLGLPRL
SVTDNFFSLGGHSLLATQVVSRLRSALGMELPLRALFECPTVEALAQRLGAQAPASTRRV
SAPVIVPRAVEAELSFAQQRLWFLDQYQPGSAVYNMPAALRLEGVLDAAALERAFTELVR
RHQSLRTTFRVREDNPFQVISPASSWSLEVTDLGHLPPAEREAEALRLAQEDARQPFELT
RGPLLRTKLLRLTAREHLLLVTMHHIVSDGWSLAVLIREVVTLYAAFSAGRSSPLPELPI
QYMDYAAWQREWLQGEVLEQQLGYWKKQLEGAPPSLELPTDRPRTADTRNPGASLKVELP
PRLMHGLKALCQREGATLFMGLLAGLQAVLARYTGQDDICVGAPIAGRTQAQTEELIGFF
VNTLVLRTRLEGNPSFRELLGRVKDVTLGAYAHQDVPFEKLVEVLQPPRQQLGRTPFFQV
ALGLLNTPTAELSVPGLSVQPLPLDSGTARFDLSLSLTESAQGLNGELEYRSDLFEASTA
ARMMEHLRLLLEDAVAHPERRLSQLSLMSEAERRQVLVEWNATAVDFPREARVHELFEAQ
AARTPDAVAVVFEDQQLTYAELERRSRQLSHHLRALGVKPGDRVALCMERSLELMVGLLG
ILEAGAAYVPLDPSAPRERLAFMLEDTAAPVLLTREHLRASLPSFPGHLVVLDTGWEAIS
QAAPLPPSGVTPEHPAYVLYTSGSTGQPKGAIISHGALANHMAWLLSTFGLGAGERVLQK
TPLSFDASVWECWAPLLVGAPLVLAPPEAHRDPAALVECVVRQRIHVLQVVPSLLRFMLD
EPALAQATDLRWLFCGGEALPSELAVRLRAVLPEVRLVNLYGPTETTIDATWAAISGQEP
GGTLPIGKPVANTQVYVLDAALRPVPIGVPGELYIGGVQLALGYLGRPMLTAERFVPNPF
GTEPGARLYRTGDRVRWLRDGQLQFLGRIDFQVKVRGLRIEPGEVEGVLARHPAVREAVV
VAREDLAGGTGLVAYVTTRPGEAVETAALRTFLRDSLPEYMVPSAFVVLDALPLTRNGKV
DRRALPAPEAPRADESLIAPRTDTEQKLAGLWRELLGLEQVGVRDDFFELGGHSLLATRL
LSRLRGTLQVELPLQALFEARTLEAQAERVEAAMGVKQPLQAPALRPVPRREHMPLSFAQ
QRLWFLEQLEPGLSTFNIPIFLRFEGNLDMRAMEHAFQELVRRHESLRTVIQEGPEGPAQ
RVIPSVEMVLARVDLRELPPGTREQETRRLKEVEAQRPFDLTKGPLMRATLLWLEDEVHL
LLLTMHHIVSDGWSLGVLVREVVEQYTAHQEKRSARLSALPVQYADYAAWQRQWLQGEAL
EAQLSYWRRQLEGAPAVLELPTDRPRPAVRGYRGGTLLSTLDTQLTRKLEALALRERSTL
FMVLMAGFHSMLHRYSGQTDVVVGTDVANRNHVETEPLIGFFINQLVLRLKLEGNPTFRE
LLAQAKRVSMEANSHQDVPFEEVVRALNPERSTAHAPLFQVKLVLQNMPLSAPELPGLKL
SHEDQVPVASKLDLTVLVTPTAEGLVCSWMYSTDLFEASTVERMARHFQRLLEGVVAHEG
RQRLSELPLLTEDERRRVLVEWNDTAAPYERRCIHELISEQAARTPGAVAVVAADGQLTY
AELERRANQLAHWLKALGVAPETRVGLFVERRAHALVGLLGILKAGGAYVPVDPSSARFP
ERVLHVLKDARVQVIVTEEALAEELPSQGGFVVSLDAEDGLLESQPEEAPESEVSPGNAA
YVIYTSGSTGRPKGVCIEHGQLACYVAGVSQRLELPEGMSFASVSTLAADLGHTALFPTL
CAGGTVHLVEKETASDAGLLAAYGRKHGVEGLKVVPTHLEALLAGEDAQALLPRRRLVLG
GDTSEWALVEKVHALAPECEVYNHYGPTETTVGVLAAKVERGARVPGAQSVPLGRPLGNV
RVYVLDGYEQPVAPGVPGELYIGGESVGRGYLGRPDLTAERFVPDRFSGVAGARLYRTGD
RVRWLEGGRIEFLGRVDHQLKIRGYRVELGEVEAALGQNPGVSECVVVAREEAGGNKHLV
AYAVGRPGSTLEERGLRTYLEERLPDYMVPAAFVVLETLPLTSNGKVDRKALPAPSRSKA
RETYVAPRTGTEQRLAELWRELLNVPRVGVHDDFFELGGHSLLATQVVARVGTLFGAQLA
VIDLFEAPTLEKLAARIEAGSTSDSPLVTLRKGGSGRPFFCVHPVGGSVLGYLELARRLD
AEQPFYGLQVPASGSGETVEEMAARYLEAVREVQPEGPYLLGGWSMGGRVAYEMARQLEA
RGERVALLAVIDARGREEAAGTEAAPETMVEQAVFEFAEHLSRLSGLHPRAAEVLEQVDA
VELKSVLEGRAHPLVEEAAADEVRALWRMYARNRSASRTYEPKPYGGALVLLRAAEGAEG
QEKDLGWGELVRGGVEVHEVPGDHFSLIAMPHVEHLAARLRELLKRAGTSGGLQQAG
NT seq 25554 nt NT seq  +upstreamnt  +downstreamnt
atgccccagccacgttccctcgtcgccctcctcgaagagcgaagtgccacccgttcggag
cagcgcctctacaccttcctggaggaaggggacgcggaaggggttccgctgacgcgaggg
gagctgtacacgcgcgcgcggcggattggcgccgtcctccaggagctggcgcccgcgggc
gagcgcgccgtgctcctctatcccccgggcgccgagtacctcaccggcttcttcgggtgt
ctcttctccgggctggtcgcggtccccgcctacccgccggatccctcgcgcctggagcgc
accctgccccggctgagggccatcatccaggactcgcgcgccacggtggtgctcaccacc
tccttcgtcctctccatggcggagctcatcttcgaggccgctccggatctgagggccctg
cgctgggtggccaccgatgagctcaccccgggtgccgaggcgggctggaagcggccggac
gtgacgagcgactcgctcgccttcctccagtacacctcgggctccaccggcacccccaag
ggcgtgatgctcagtcacgccaacctgctgcacaacctggagctgatccgcggcgccttc
cagacgcgcgaggacagcgtcggcgtcatctggctgccgccctaccacgacatggggctc
atcggcggcatcctcgtgccgctgtaccagggcttccacaccgcgttgatgtcgccgctg
tccttcctcaagcgcccccgcgcctggctggaggccctcacccgctacggaggcaccatc
agcggcgggcccaacttcgccttcgagctgtgcgtccgccgcatcgctcccgaggagcgc
caggggctggacctgagccgctgggaggtggcgttctgcggcgccgagcccattcgctcc
ggcatgctggaccggttcaccgaggccttcgctccccacgggttccgccgcgaggcgttc
tacccctgctatgggctggccgaggccaccctcatcgtctcgggcggcgcgaagtccgag
ccgcccctcgtgcgcgaggtggaggctatcgcgctcgagcggggtcatgcggtggagccc
cgcccggggctcgaggcccgcaccttggtgggctgcggcggcacgctgggagagcaacgc
gtcgccgtggtggatcccgagtccctccagcagctcccacccggcgaggtcggtgagatc
tgggtgagcggccccagtgtggcccatggctactggcaacagccggaggagtcggcggcc
accttccgcgcgcgcaccgccagcggagaaggcccgttccttcgcaccggcgacctgggg
ttcctcgacaagggcgagctgtacgtgaccgggcggcgcaaggacctcatcatcctgcgc
ggccgcaacctctatccccaggatctggagctcacggtggagcagagccacccggcgctc
cggcccgggtgtggtgccgcctttggcgtcgaggtcgacggcgaggagcggctcgtggtg
gtacaggaggtggacccgcgcaagctggacggcgccgcggaggacctcgtgggcgccatc
cggcagaggctcgccgaggggcacgaggtgcggccccatgccctggtgctcatcgagccg
ggcagcctgccgaaaacctccagtggcaaggtgcaacgccgggcctgccggaccgcgttc
ctcgcgggcgagctccgcgtggtccatgcctcacacgcctcggagcccgctgcacgggcg
ccgtcctcgccctcccctgctcctcgcgccgcctccagtgagctggaggccctggtgctg
gcgcggatcgccgcccggctgggcgctcccgtggagtcgttggatccggacatgccgctc
acccgcctcggcctggactcgctggccgcggtggagctggcgcacgggctggagaaggcc
ctcggtgtgccgcttcccatggagacgctgttgagcggcgtgagcgcctcggagctggcc
cgcgagctctccgcccggaaggcggcggccggtgcgcgtccggcgattcctcgcgcgtcc
cgtaccgcgttcccgccgctctccttcgcgcagcagcggctgtggttcctcgaccggctg
gagccgggcagtgccttctacaacctgcccgtggtctcccggttgaatggagtcctggat
gtgccggcgctggagcggagcttccaggccctggtccagcggcacgaatcgctccgcacg
gtgttcctcgagaaggacggcgagccgtaccagaacatcctggccgagcaggccctgccg
ctccccctcgtggacctgagcggtctgccggaggacgcgcgcgagcaggaggcccagcgg
ctctcgcgcgaggaggcccagcgccccttcgagctctcccgggggcccctgctccgggcc
accctgctgcgcctcggtgccgagcggcacctgctgctgctcacgctgcaccacatcatc
gcggatggttggtccatgcgcgtcctggtgcgcgagctggaggagctccaccgggccttc
tccgccgggcacacgcccgctctcgacgccctgcccctccagttcgcggattacgcgctc
tggcagcgtgaatggctgcggggcgagcggctcgaggacctcgtcggctggtggaaggcg
cacctcgccggggctcccgccgtcctggagctgcccggtgaccgtgcccggccccgggcc
cagtcctaccggggcgcgcaggtggtccggcggctcgaatcggcggcctgggagcgcgtg
aaggcgctcgcccgccgcgagggcaccacccccttcgtcaccctgctggccggcttccag
ctcctgctgcaccgctacaccggccaggaggacctcgtcgtcggcgtggacaccgcccac
cgctcccggcccgagacggccgggctcatcggcctgttcgtcaaccagctccccgtgcgc
ggcaacctcgcgggcgcgcccaccttccgcgagctgctcgcgcggctccaccaggagaca
ctggacgtctgggcccaccaggacctgcccttcgacgagctggtgcgtggactcaacccg
gagcgcagcctcgcgcatgcgcccgtcttccaggtgaagctggtgctccaggaggccgtc
cccgcgtcgctgggccgctcgggcctgtccctggagagcaccctgggggacaccggtgcc
accaagctcgatctcaccctctccgtcaccgacaccgcccacggcctcgagctgctctgc
gagtacgccaccgacctcttcgacgcgagcaccgtctcccgcctgctggggcacctgtgt
ctcctgctcgagagcgccgccgcggctcccgagcgccgtgtctccgagctgcccctgctc
tcccaggaggagcgtcacctcgcgctggtggagtggagccggaccacgcccgcggtcccg
gaggactgcgcgcaccgcctcttcgaggagcaggcgcggctcacccccggagccaccgcc
gtctccctgggcgagtcgtccctcacctaccgggagctggaggcacgcgccaaccagctc
gcctggcacctgcgctccctcggcgttggaccggacgtggtggtgggcatccacctggag
cgcacaccggagctcgtcgtggcgatgctcggcgtgctcaaggccggcggcgccttcctg
ccgctcgacaccagctacccgtccgcacgcctggagctgatgctccgcgaggcccgcgtc
cccgtgctcgtcagccgcgaggccctcgcggattccctgggctcccagggcgagctgctg
gtgctcctggacacggagcgctccgcgctggcgctccagccggagacggcgctctctccc
gcgccagccgtcacgccctcgaatctggcctacatcatcttcacctccggctccaccggc
acccccaagggcaccctgctggagcaccatggcctgtgcaacaccgcccgcgccacccac
gaggcgctcggcctgcgtcctggcaaccgcttcctgcaactggcggccatcggcttcgat
gcctccgtcagtgagatcttctccacgctgctctgcggcgcggagctggtcctcgccccg
cccgagtcgctgctgcccgggcctccgctgcagcaggtgctcgcggagaaggccatcacc
accatcaccgccacgcccacctcgctcgctccgctggagccggaggccctgccagccctg
gccgtggtggcctccgtcggcgaggcgtgcacgccggagctggcccggcgctggaagcat
ggccgccgcttcctcaacttctacggtcccaccgaagcgaccgtctgcgcgaccatggag
cgggacgtggagccccgccagccgtccatcggccgcgccatcccgggcgcccagacgtac
gtgctggacgcgcgcctggagcccgtccccgtgggcatccccggcgagctgtacgtgggc
ggcgcgggcgtggcccgtggctacctgaaccgccccgcgctcaccgccgagcgcttcgtg
cccaaccccttcgccaccctccccggagagcggctgtaccggacgggggacctggtgcgc
ctgctgccggatggacgcctggagttcctcgggcggcgcgatgcgcaggtgaaggtgcgc
ggcgtgcgggtggagctcggagaggtggaagcggcgctgggcctgtaccccggcgtgcgc
caggtggtcgtcgtcccgcgcgagagcgccggtgaagcacggctggtggcgtacgtcgtc
gccggtgaggcgatggagccggcggtcctgcggcgcttcctcaaggagcggctccccgag
gtgatggtgccctccgccttcgtgcggctggacgcgctccccatcaccccgggcggcaag
gtggatcgccaggcgctgccctcgcccgacgcggtgagccccgcgccggacgcgcccttc
gccgagccccgctccgagctggagcggcgcatcgcctccgtctgggcccgcgtgctcgag
gtgcctcgggtggggctgcacgaccacttcttcgaggacctgggcggcagctcgctgctg
gtggtgaaggcgagcacgcagctgcgcgacgagctgggccagaccatcccggtcacccac
ctcttcgagcaccccaccgtgagcaagctggccgcgcggctggagcgggagctcccggcc
cgtgcccccgagcccgcgccccgccccgccccctccggagatgacggctcccacgacatc
gccctcatcggcatggccggacgcttccccggtgcgggggacgtccacgccttctgggag
aacctgcgccagggcgtggagtccatctcgcgcttcgctccggaggagctggagccctcg
ccgctgttccccgactcgctgcgagatcatccggacttcgtccccgcgggcggagtcctc
gagggcgcggatggattcgatgcccgcttcttcgagctgtcgccccgcgaggcgcagtgg
atggatccgcagcagcggctcttcctccagtgcgcgtggcatgcgctggaagacgccggc
tatgacccggagcgcttccaggggcccatctcgctccatgccggagcggggacctcgagc
gtgcacctgctctcgctgctcggccagacgcgcaaggacccggcctcgctgttcgaggcg
ctgggcaccaccagtggcgagaacgtggccaccaagacggcctacaagctggggctctcg
ggtgagtgcctcaacgtctataccgcctgctccaccggtctcgtcgccgtccacctggcc
tgccagagcctgcgcacccgccagtcggacctcgcgctcgctggagcggtgaaggtctcg
ctgccgcagcgcaccggctacctcttccaggaggggatgatcctctctcccgacgggcac
tgccgcgcgttcgacgcgagcgcccggggcaccgtgctcggcaacggcctgggcgtggtg
gtgctcaagcggctctcggacgccctccgcgatggggaccacgtctacgccgtcatcaag
ggctcggccctcaacaacgacgcctccgccaaggtcagctacaccgcgcccagcgtccag
gggcagagcgaggtcatcgcccgcgccctggcctcggcgggcgtggacgcctccagcatc
ggctacctggaagcccacggcaccggcacctcgctgggagatccgatcgagatcgccgcg
ctcacccgcgcctaccgcgcccagaccgagcgcacgggctactgcgccatcggctcggtg
aagaccaacatcgggcacctggacaccgccgccggcatcgcgggcctcatcaaggccgcc
ctcgcgctgcaccatggcgagctgcccccgagcctccatttcgagcgccccaacccggag
atcgacttcgagcacagccccttcttcgtgaacaccgccccgcgcacctgggagcgcggc
gagggcccgaggagggccggtgtcagctcgttcggcatcggcggcaccaacgcccacgtg
gtgctggaggaggccccccgccagggcggcggaggacacgggagccaccgcacccggcag
ctcatcacgctgtccgcccggagcgcgtccgcgctggaagccatgacgcacgcgctggcc
ggcttcgtcgcgacccaccccgaggtggagctggcggacctggccttcacgcgcaacgtg
ggccgcaagtccttcgagtaccgccgggcactggtcgcggaggattccgcgggcctgcta
cgcgcgttgcgccacccgggcactccgtccgaggtgcgtgacctggaagccgcccgctcc
cgccgggtggccttcctcttcccgggccagggcgcgcagtccgtccggatggcccaggag
ttgtacacgtccgagccgatcttccggcgcgagctggacgcctgcctggcgctgctgccc
agggtgggcctgtcggaggacctgcacccggtgctcttccccgagccgggttccgaggcc
cgggcggaggcgcgtctcgccgagcctcgcttcgcgctgcccgcgctcctgtcggtggag
tacgcgctcgcgcggctgtggatgggctttggtttcacgccttccgcgctgctcggccac
agcttcggcgagtacacggcggcgtgcctgtccggagtgctctccctggaggacgcgctc
cggctggccgtcgttcgcggcgagctcatgtcccggctcccgcccggcggcatgctcggg
gtggggctctccgcctcggaggtggcgccactgctctccggtgagctggagctcgccgcc
ctcaatggcccggatcgctgcacggtgtccggtcccgtcgaggccctggaggcactggag
cgccagctgtccgcgcgccgcgtgggcgtgatgcggctcgccgcggcgcacgcgttccac
tcgcgcgcggtggagcccgtcatggccgagctggagcgggccgtggccggactcacgttg
aacgcgcccaccattcccttcgtgtccagcctcaccggcacgtggatccgccccgaggag
gccacctccccgcgctactgggcccggcagatgcgcgagcccgtgcgcttcgcctccggg
ctggacgcgctggtggacgccggctgcggctggttcatcgaggccggcccggatcaggcg
ctcaccgcgctcgtcaaaccgcgactgcggaacgcgcgtgaagcgctggtggtgccctcg
ctccgccgaagcggcacctccacgtccgacgcccagaccctgctggagtccctcggcgcg
ctctggcgcgcgggcgcggccgtggactggaagggcttccacgcccacgagcaccgccgc
cgcatcccgctcccgggctatcccttcgaggagaagcggatctccctcgaggagcgtcct
gtcctccccctgccgctcccggccgctgcccccgttcccgcgcccactgccgcagccacc
gtgccgccgcccgcggcgcccgtgattcccgaggcgcgtgcgccccagggtgacatccag
cagcgcctgacggagctgtggcgcgagcggctgggcgtggaggacatcggtccggacgac
agcttcctcgacctcggcggcaactcgctgatggcggcgcagctcctcacccggctgcgc
gagacgttccgggtgcagatccccctcagcgatctcttcgaagcgcccaccatcgccggc
ctggccgcgcgcatcgaggcccggctccaggtggagctgcccgccggcgaggccgcggcg
gcggcgatgctccccgtcccccgtaccggagagctgcccctgtcctacgtgcaggagcgc
gtctgggagatggagctgcgggagccgggcagctccatcttcaacgagcccctggcgatc
cggatctccggcgcgctgcggcccgacctcctggagcgcggcctcaacgaggtcatccgc
cggcacgagtcgctgcgcaccgtcttcgcccaggtggacggcagggccacgcctcgaatc
ctctccgaagtgcgcatctccctccccgtggtggacctgcgcggcttcaccggggaccgt
gaggccgaggcgatgcggctggcccgtctcgcgcccgccgagccgttcccgctcgaccgg
ggaccgctggtccgcgtgcagctgctccgcatggccgaggccgagtacatcctgctcgtc
accatccaccacatcgtggcggacacgctgtccctggtgaacttcatccgggaagcggtg
gccttctacaccggcttcgtccacgggcggcccgtgcccctgccggagctgcccatccag
tacatcgacttcaccgtctggcagcgccgcgcgctcgccgatggcacgctctccgcgcaa
caggcgtactggcgcaagcagctcgcacggcgtccgggtcccctgccccttccgctggat
cgtccgcgtgccgaaggtgcgcgccgccgcggtgcacggcactcgttcgccttccccaag
gcgctcggcaccgcgctccaggccttcagccagcgcgagggcctcacgccgtacatgacg
ctgctcgccggcttcaaggcgctcctggcccgctgctcgggtcaggaggacatcctcgtg
ggcacctccatcggcaaccggacgcgccccgagctggagccgcagatcggctacgtggca
cacgccctcgccctgcgcacctccctggagggagacccgagcttccgctcgctggcgctg
cgcgtccgcgacaccacgctctccgccttcgcccaaccggacgtgccctacgagcagctc
ctcggagagctcgagcccggtgaggaggcgcggctgtcgcgcctgttcgacgccatcttc
ctgctgcacacgcaggacgtgtccgcgcccatcctggagttcccgggcctgcggttgagc
tacttcgacgtcaccggactgcccgcgcagtacggcacgtcgctcgcggacctcacgctg
ctgatgcgcgaggacgcgcagggcttctccggcacgctggagtacgccgtcgatctgttc
gacgccgccaccatcgtccggctgctctcgcagttggaggcgttgctcaccgacgcggtg
gcctcgccggacaagcccctgtcccagctgtccctggagggagccccggagcggacggga
ggcccggtgaccggagcctccgaggccgcctccctcgtggccctgttgtccgcccaggcg
gagcgtgcgccggaggcggtggcgctccgtcgtggagaccagcgcctgacgtggcgggcc
ttgcgtgcccacgcgcacgcgctcgcgtccggactgcgcgcccggggtgtgggcccgggt
gtccccgtggccgtgtgcctggagccctctcccgagcgcgcggtggccctgtggggcgtg
ctggcctctggcggcgcctatgccctcgtctcgcgggagcactccgaggagctgtccacg
ctcgggctggacgggtcctcgcccctgctcatcaccaccgcttcgctgccgctgcctccg
cgactggacgagagccgggtcatccgcctcacgctctccggtgagcccccggccgagtcc
ttccccgcgaccgtggccgctgacagcctcgcctgcctggtgcgggagacggaggacggt
gggcgcccgcgcctgatgtggagccaccgcaacctgctccaccgattcgccgcgctggat
gcccgcgtggacacccgcccgggcgagacgtggctgagcgcctcggacgcctcggcggat
ccggcgggcgtggagctgctctgggcgctcgcacgaggactccaggtagtgttcccggtg
cagccggcggcacggctcgtggtgctccgcccggagcaggccgcgacccggcagctggac
ttcagcctcttctacttcgccaacgacgcggaggcctcgggccggaagaagtaccagctc
ctcatcgacggagcgaagttcgccgacacgcacggcttcagcgcggtgtggacgcccgag
cggcacttccatgccttcggcggcccctaccccagccccaccgccaccagcgcggcgctg
gccatggtcaccgagcgcgtctccctgcgcgccggcagcgtggtgctcccgctgcatgac
ccgattcgtgtggccgaggagtggtccgtcatcgacaacctctccgatggccgtgcgggc
gtgtccttcgcgacgggctggaacgcgaacgacttcgtcttcgcgccccagaacttccat
cagcgccccgaggccatccggcgcggggtggaggaagtgcgcaccctgtggcgcggcggc
agcgtgcgccgcaccaacggcaccgggaccgaggtggagatctccatccgtccccggccg
gtgcaggaagagctgcccatctggatcaccgccgccttcaacccggagaccttccggctg
gcgggcgagctgggcacgggcctgctcaccaacgtgctggggctgggacaggacttcgag
gagctggcgcggaagatctccatctaccgcgaggcacggcgcaaggcggggcacggccgg
ggccacgtggtgctgatgctccacaccttcgtggcgggcagccaggaggacgtgaagcgc
caggcgcgcgagccgctcatccgctacttccgcagctcggtggagctgttcaacgggctg
gtggcgaaccagggcctgggcttcgacgtgcgcgacctcacgccgcaggacatggagatc
ctgctgcaacagggcgtctcgcggtacctggaggcgggcggcatgttcggaacgcccgag
acgctcgcggcccgcgtggagcagctgcgccaggcggacgtggacgaggtggcctgcctc
atcgacttcggcctgggccatgaggccaccatggagggcctgcggcacctggacgtgctg
cgccgccggagccaggagggacagtcctccgcgcccaccactccggtgctcgtggaggcg
gatggcctccgggtgctggcggagtcgctgcgcgccagccctccggcacacctgcgctgc
accgccgcgctcgcgcggtcgctcgcgaggatgccggatgccgccgaggtcctcggcccg
gtgcgcacgctggtgctggatgaagccgacggactcccggcggatgtagccgaatcgctg
aagcgggtggcctccgcgcgtgtcgtggcacccgtgtccctgctgcccgacacgaaggac
gccgcttcccggacgtcccggttcgtgctggacgccgcgggacgccgcgccccggtgggc
gtggtgggcgagctgttcctcggaggcgacgcggcacccctgggcttctggaaggcgccc
gagctgacccggacccggctccgtgcctcgcccgacggcacggaggcccgtctgtatggc
accggcactcccgcccgctaccgcgcggacggtgaggtggaggttgtcacgcccacggcc
cggcgccgccctgccccggtggagcccaccccgagcacgcccgctccggtccgccccgcg
gctcccgcggtccgggaaggtgtcatcacccgcgcgccccggaatgagctgccgcccctg
tcgtacgcgcagcagcggctatggttcctggaccagtaccagccgggcagcgcgctctac
aacatgccggcggcgatgcggctgaagggcacgctcgacgtcgccgccctgggacgggcc
ttcgccgatgtgattcgccgccatgaggccctgcacacgaccttccaggcccgtgagggc
gaggcggtgcagatcatctcgcccgacatggcctgggcgctggaagtggaggcgctgggg
cacctgccggaaccggagcgggaagccgaggcgatgcgcctggcgagcgaggaggcctcc
cggcccttcgagctcacccggggaccgctgctgcgcgcgaggctgctgcggctgacggcg
gaggagcacgtgctgctggtgacgatgcaccacatcgtctcggactcctggtccgtcggc
gtgctgatccgcgaggtcgtcacgctctacgcggcgttcgccacgggaaggccctcgccg
ctgcccgagctgcccatccagtacgcggactacgcggtgtggcagcgcgagtggatgaag
gggcaggtcctcacgcggcaggtggagtactggaggaagcagctcgagggagtccctccc
gcgctggagctgtccacggactggccgcgcaccgcgaacacgcgcaatcccggcgcctcg
ctgagggtggagctgcctctggagctgacgcagggcctgagggcgctgtgccggcgtgag
aagggcacgctgttcatgggcctgctcgcgggcctgcaggtgctgctggcgcgctacacg
gcccaggacgacatctgcgtgggcgcgcccatcgccgggcgcaaccagccccagacggag
gcgctcatcggcttcttcgtcaacacgctggtgctgcggggccagctgcacggggacccg
agcttcctcgagctgttgaggcaggcgcgggaggtgacgctcggggcgtacgcgaaccag
gacgtgcccttcgagaagctcgtcgaggtgttgcagcctccgcggctgccggagcacacg
cccttcttccaggtggcgctggtgctgctcaacacgccctcggcggagctgacggggccc
gggctcaccttccggccgctggaggtggactcgggcaccgccaagttcgacttcacgctg
gtcatcaccgagacgccgcgcggcctgagcaccacgctggagtaccggagcgatctgttc
gaggcctccacggcggcgcggatgatggagcacctgcgcctgctgctggaggacgcggta
gcccaccccgagcggcgcatctcccagctctcgctcctgtccgaggcggagcggcgccag
ctgatggtggagtggaacaccaccacgccggagcccgtccgctccttctgcatgcaggag
ctgttcgaggcccaggccgcgcgcaccccggacgcggtggcggtcgtcttcgaggacagc
cagctcacctacgcccagttggagcaccgcgccaaccagctcgcccacgtcctgcacgca
cgaggcgtccgcccgggtgtctgggtggccatctgcctggagcgctcgctcgagatgatc
gtggccgtgctcgccgtcctcaaggcgggcgcctcctacgtgccgctggatcccgcctac
cccgcggagcggctgaccttcatgctcgaggacaccggcgcgaccgtgctcctcacccag
gagcacctgcgcgccacgctgccccccttctcgggccacgtgctggagctcgacgcctcc
tggcgggccttctcccaggtgtcttccgagcccctggcctccggcgtcacgccggggcac
cccgcctacatcatctacacctcggggagcacgggcacgcccaagggcatcgtcatgccg
caccgggcgttgagcaacatgctcgtgtggcagatacgccagtccaacctcccggaggcc
aacaccctccagttctcctcgctcagcttcgacgtctccatccaggagttcttcaccacc
tgggccaccggcggcaccctcttcgtccccaccgccgccgttcgccgggacatccccgcg
ctgctcgcgtacctggtgcgccatcgcgtgcagcggctcttcgtgcccttcgtcgtcctg
caggccctcgccgacgcggtggcccacggggcgcccctcccctccagcctgcgcgagctg
gtgactgccggtgagcagctccaggtgacgcccgccctcgtggccctcttcgagcggctg
cccgggtgcgtgctggagaaccagtacggcccctcggaagcccacgtggtgacggcccac
cggctgcgcggccctcccgcctcgtggccgcgtctgcctcccgtgggctcgcccctgccc
aacacgccgctctacgtgctggatgcgcacggccagctctgccccatcggcgtgcgcgga
gacgtgtacgtgggcggcccgcagctggcgctcggctaccacgagcgcccccacgtcacc
gcggacaggttcgtccccaacccgttctccggtgagcccggagcgcgcctctaccgcacc
ggcgatcatgtccgctggagggccgacggcaccctggagtacctgggccgcctggacggc
caggtgaaggtgcggggcttccgcatcgagatgggtgaagtggaagcggccctgcgcgag
gccccgggcgtccgcgacgccacggcccaggtgcgcgaggacgctccgggtgacaagcgg
ctggtgggctacgtggtgctccacgcgggcatcgactgggagcccgaggccctgcgccag
tccctggccctccggctgcccgagtacatggtgccctcggccctggtgcggctggacgcc
ctgccgctcaaccccagtggcaagctgaaccgcgccctgcttcccgctcccgacgcggac
agcctgcgcggtgccgcgcccttcgtcgcgcctcgcaccccggtggagcagacgctcgcg
gacaccttcgccagcgtcctgggcctgccgcgcctgagcgtcaccgacaacttcttcagc
atgggcggccactcgctgctggccacgcagatcgtctcccggctgcgctcctccctgggg
gtggagttgcccctgcgcgccgtcttcgaggcccccaccgtggaggccctcgcccgccgc
gtcgaggcccagacagggacgggagagaacgcggctcgcaagtcggtggtcatgccacgc
acggggctgagcgaaggggagctgtccttcgcgcagcagcggctgtggttcctggaccag
taccagccgggcaccgcgctctacaacatgccggccggcctgcggctggagggcgtgctc
gacgtgggcgccctggagcgggccttctccgagctggtccgccgccacgaggtgctccgc
acgaccttccaggtccgtgagggcaagccggtccaggtcatcgctccggcctcgcaccgg
gcactggaagtgacggacctgggacacctgccgcggcccgagcgggaagcggaggcgatc
cggctggcgcaggaggacgcgcttcaaccgttcgacctcgcccgcggccccctgctgcgc
acgaggctgctgcgcctggccgggaacgagcacctgctgaccatggtgctgcatcacacc
atctcggacggctggtccatcgccgtgctgatccgcgacatggtggcgctgtacgaggcc
tgcgtcaccgggaagcccgcgccactgcccgagctgcccatccagtacgtggattacgcc
ctgtggcagcgcgagtggctccagggtgaagtgctggagcagcagcttggctactggagg
aagcaactcgagggggcgccgccctcgctggagctgcccaccgaccggcctcgcaccacg
gacacgagcaatcccggcgcctcgctgaacgtggagctgccgctggagctgattgagggg
ctcggcgcgttgtgccagcgcgagggagccacgctgtacatgggcctgctcgcgggcctg
caagcggtgctcgcgcgctactcggggcaggacgacatctgcgtgggcgcgcccatcgcc
ggacgcacccagacgcagacggaagagctcgtcggcttcttcgtcaacacgctggtgatg
cgcacccggctggagggcaacccctccttccgcgagctgctcggccgggtgaaggacgtg
acgctcggagcgtacgcgcaccaggatgtgcccttcgagaagctggtggaggtgttgcag
cctccgcggcaaccggagcacacgcctttcttccaggtggcgctggtgctgctcaacacg
cccacggcggagctgagcgtgcccggactcaacctccggctgctggatctggacacgcgc
acctcgaagttcgacttcacgctgaccctgcgccaggaggggcaggggttgaatggcgtc
ctggagtaccggagcgacctgttcgaggcctccacggcggcgcggatgatggagcacctg
cgcctgctgctggaggacgcggtggctcatcccgagcggcgtctgtcccagctctcgctc
atgtccgaggcggagcggcgtcaggtgctggtggaatggaacacctccacggcggcgcct
tcacgccccaggtgcgtgcacgagctgttcgaggcccaggccgcgcgcactccggacgcc
gtggcggtggtgttcgaaggcagtcagctcacctacgcccagctggagcaccgcgccaac
cagctcgcccacacgctgtccgcgcgaggcgttcgccctggcgacagcgtggccctgtgc
gtggagcgttcgctggagatggtcgtggccgtgctcgccgtcctcaaggccggtgccgcc
tacgtcccgctcgaccccgcctaccctgccgagcgtctggccttcatgctcgaggacact
ggcgctcccgtgctcctcacccaggagcacctgcgcgccaccctgccccccttcccgggc
cacctgctggtgctcgactccacctggcaggcgttctcccagacgtcgcctctgccccgg
gtctccggcgccaccccggagcaccccgcctacgtcatctacacctcgggcagcacgggc
aagcccaagggcgtcgccctgccgcaccgcgcgctctccaacctgctggactggcagctg
aagcagtccgtccaccccgcggccaccaccctccagttcgcctcgctcagcttcgacgtc
tccttccaggagctcttctccacctggtgcgctggcggcaccctcgtggtcccgagcgcc
gccgttcgccaggacatgcccgcgctgctcgcgtacgtgcagcgccagggcgtccagcgg
ctgttcctgcccttcgtcgccctgcaagctttcgccgacgcggtggcccatggcgcgccg
ctgcccaccagcctgcgcgaggtggtgacggcgggtgagcagctccaggtgacgcccgcc
ctcgtcgccctcttcgagcggctgcccgggtgcgtgctggagaaccagtacggcccctcg
gaaacccacgtggtgagtgcccaccggctgcacggccctcccgcctcgtggccccgcttg
ccgcccatcggctcgccgctacctctcaccccgctctacgtgctggacgcccaaggccag
ccctgccccgtgggggtgcgcggagagttgttcatcggcggtgtgcagctggcgctcggc
taccacgcccgtcccccgctcacggccgagaaattcgtcccccacccgttctccgaacag
cccggagcgcgcctctaccgcaccggtgaccgggcccgctggagggccgacggcaccctg
gagtacctgggccgcctcgacggccaggtgaaggtgcgtggcttccgcatcgagcagggt
gaggtggaagccgccctgcgtgaggccccgggcgtccgtgacgcggcggccctcgtgcgc
gaggacgttcccggcgacaagcggctggtgggttatgtggtgctcgaccccggcacctcc
tgggagcccgaggcactgcgccagtccctggcgcgcaggctgcccgagtacatggtcccc
tcggccctggttcgcctggaggccctgcctctgacgcccagtggcaagctggcccgccgc
ctgctgcccgctcccgacgcggacagcctgcgcggtgccgcgcccttcgtcgcgcctcgc
acgccgctggagcagacgctcgccgacaccttcaccagtgtcctgggcctgccgcgcctg
agcgtcaccgacaacttcttcagcctgggcggccactcgctgctggccacacaggttgtc
tcgcgcctgcgctcggcgctgggcatggagttgccgctgcgcgcgctgttcgagtgcccc
accgtggaggcccttgcccagcgcctcggcgcccaggcaccggccagtacccgccgggtg
tccgctccggtgattgtcccgcgcgcggtcgaggccgagctgtccttcgcccagcagcgg
ctgtggttcctggaccagtaccagccggggagcgcggtctacaacatgccggccgccctg
cggctggagggtgtgctcgacgcagccgcgctggagcgcgccttcacggagctggtgcgc
cgccaccagtcgctccgcaccacgttccgggtccgcgaggacaaccccttccaggtcatc
tcgcccgcctcctcctggtcactggaggtgacggacctggggcacctgccgccggcggag
cgagaggcggaggccctgcgtctggcacaggaggacgcgcgccagccgttcgagctcacc
cgcgggccgctgctgcgcacgaagctgctgcggctcaccgctcgggagcacctgctgcta
gtgacgatgcaccacatcgtctcggatggctggtccctcgccgtgctgatccgtgaggtg
gtgaccctctacgcggcgttctccgcgggaaggtcctcaccgctgcccgagctgcccatc
cagtacatggattacgcggcgtggcagcgcgagtggctccagggagaggtgctggagcaa
cagctcggttattggaagaagcagctcgagggggcgccgccttcgctggagctgcccacg
gaccggccgcgcaccgcggacacgcgcaaccctggcgcctcgctgaaggtcgagctgccc
ccacgcttgatgcacggcctgaaggccctgtgccagcgcgagggagccacgttgttcatg
ggcctgctcgcgggcctgcaggcggtgctggcgcgctacacgggacaggacgacatctgc
gtgggcgcgcccatcgccggacgcacccaggcccagacggaggagctcatcggcttcttc
gtcaacacgctggtgctgcggacccggctggagggcaatccctccttccgcgagctgctc
ggccgggtgaaggacgtgacgctcggggcgtacgcgcaccaggacgtgcccttcgagaag
ctcgtcgaagtgttgcagcctccgcggcagcagctcgggcgcacgcccttcttccaggtg
gcgctgggtctgctcaacacgcccacggcggagttgagcgtgcccggcctgagcgtccag
cccctgccgctggacagtggcaccgcccggttcgacctctcgctgtccctcaccgaatcg
gcccaggggctgaacggcgagctggagtaccggagcgatctcttcgaggcctccacggcg
gcgcggatgatggagcacctgcgcctgctgctggaggacgcggtggctcatcccgagcgg
cgtctgtcccagctctcgctcatgtccgaggcggagcggcgccaggtcctggtggagtgg
aacgccaccgccgtggacttcccacgtgaagcccgcgtgcacgagctgttcgaggcccag
gccgcgcgcacgccggacgccgtggcggtggtgttcgaggaccagcaactcacctacgcg
gaactggagcgccgctcgcgccagctctcgcaccacctgcgagccctcggcgtgaagccg
ggagaccgggtggcgctgtgcatggagcgctcgctggagttgatggtgggcctgctgggc
atcctcgaagcgggagcggcctacgtcccgttggatccctccgcgccgcgcgagcgcctg
gccttcatgctggaagacaccgccgcgcccgtgctcctcacccgggagcacctgcgcgcc
agcctgccttccttcccgggccacctcgtggtcctcgatacaggctgggaggccatctcc
caggccgctcccctgccgccctccggcgtgactccggagcaccccgcctacgtcctctac
acgtccggcagcacgggccagcccaagggagcgatcatctcgcacggggccctggccaac
cacatggcgtggctgctctccaccttcggactcggcgccggggagcgggtgctccagaag
acgccgctgagcttcgacgcctccgtctgggagtgctgggcaccgctgctggtgggtgct
ccgctggtgctcgccccgcccgaggcccaccgagacccggccgcgctggtggagtgcgtg
gtgcgtcagcgcatccacgtcctccaggtggtgccctcgctgctgcgcttcatgttggac
gagcccgcgctggcccaggccacggacctgcgctggctcttctgcgggggtgaagcgctg
ccctcggagctggccgtgcgcctgcgcgcggtgctgcccgaggtccgtctggtcaacctc
tacggtcccaccgagaccaccatcgacgccacgtgggcggccatctcgggccaggagccc
ggcggcacgctccccatcggcaagccggtggccaacacccaggtgtacgtgctggacgcc
gcgctgaggccggtgcccatcggtgtccctggagagctgtacatcggtggcgtgcagctg
gcgctcggctacctgggccggcccatgctcaccgccgagcgcttcgtcccgaaccccttc
ggcaccgagccgggggcgcgcctgtaccgcaccggggacagggtccgctggctgcgggat
ggccagctccagttcctcggacgcatcgacttccaggtgaaggtgcgcggcctgcgcatc
gagcccggagaggtggagggcgtgctcgcccgtcacccggcggtgcgcgaggcggtggtg
gtggcgcgcgaggacctggccggaggcacgggactggtggcctacgtcaccacgcgcccg
ggggaagcggtggagacggcggccctgcgcaccttcctccgcgacagcctgcccgagtac
atggtgccctcggcgttcgtcgtgctggacgccctgccgctcacgcgcaacggcaaggtg
gatcgccgggcactcccggcgcccgaggcccctcgcgcggacgagtccctcatcgccccg
cgcacggacaccgagcagaagctcgcgggtctctggcgtgagctgctcggcctggagcag
gtgggcgtgcgggacgacttcttcgagctgggaggccattcgctgctggccacgcggctg
ctgtcccgcctccgcggcaccttgcaggtggagttgccgctgcaggcgctcttcgaggcg
cggacgctggaggcccaggccgagcgcgtggaggcggcgatgggcgtgaagcagccgctc
caggccccggcactgcgcccggtgccacgccgggagcacatgccgctgtccttcgcgcag
cagcggctgtggttcctggagcagctcgagcccgggctctccaccttcaacatccccatc
ttcctgcggttcgagggcaacctggacatgcgggcgatggagcacgccttccaggagctg
gtacgccggcacgagtcgctgcggaccgtcatccaggagggaccggagggccccgcgcag
agggtcatcccctcggtggagatggtgctggcccgggtggatctgcgggagctgccgccc
gggacacgcgagcaggagacgcggcggctgaaggaagtggaggcccagcggcccttcgac
ttgaccaaggggcccctgatgcgcgccacgctgctgtggctcgaggacgaggtgcacctg
ctgctgctgacgatgcaccacatcgtctcggatggctggtccctgggcgtgctggtgcgc
gaggtggtggagcagtacacggcgcaccaggagaaacggtccgcgcggctgtcggccctg
ccggtgcagtacgcggactacgcggcgtggcagcggcagtggctccagggcgaggcgctg
gaggcgcagctgagctactggcggcggcagctggagggagcgccggcggtgctggagctc
ccgacggaccggccgaggccggcggtgcgcggctaccggggtggcacgctgctgtcgacg
ctggacacgcagctgacccggaagctggaggcgctggcgctgcgtgagcgctccacgctc
ttcatggtgttgatggcgggcttccactcgatgctgcaccgctacagcgggcagacggac
gtggtggtgggcacggacgtggccaaccgcaaccacgtggagacggagccgctcatcggc
ttcttcatcaaccagctggtgctgcggttgaagctggagggcaaccccacgttccgcgag
ctgttggcgcaggcgaagcgggtgtcgatggaggcgaactcgcaccaggacgtgcccttc
gaggaggtggtgcgtgccctcaatccggagcggagcacggcgcacgcgccgctcttccag
gtgaagctggtgctgcagaacatgccgctgtcggcgcccgagctaccggggctgaagctg
agccacgaggatcaggtgccggtcgcatccaagttggatctgacggtgctggtgactccg
acggccgaggggctggtgtgctcgtggatgtacagcacggacctcttcgaggcctccacg
gtggagcgcatggcgaggcacttccagcggttgctggagggcgtggtggcgcacgaggga
cggcagcggctgtccgagctgccactgctgacggaggacgagcggcggcgggtgctggtg
gagtggaacgacaccgcggcgccgtacgagcggcggtgcatccacgagctcatctccgag
caggcggcgaggacgcccggtgcggtggcggtggtggccgcggacgggcagctcacctac
gcggagctggagcggagggcgaaccagctggcgcactggctgaaggcgctgggagtggcg
ccggagacgcgggtgggcctgttcgtggagcggcgggcgcacgcgctggtgggcctgctg
ggcatcctcaaggcgggcggggcgtacgtgccggtggatccgtcctcggcgcgcttcccg
gagcgggtgctgcacgtgctcaaggacgcgcgggtgcaggtcatcgtcaccgaggaggcg
ttggcggaggagctgccctcgcaggggggcttcgtggtgagcctggacgcggaggatggg
ctgctggagtcgcagccggaggaggcgccggagagcgaggtgtccccgggcaacgcggcg
tacgtcatctacacgtcggggagcacggggcggccgaagggggtgtgcatcgagcacggg
cagctggcgtgctacgtggcgggagtgagccagaggctggagctgccggaggggatgagc
ttcgcgtcggtgtcgacgctggcggcggacctggggcacacggcgctcttccccacgctg
tgcgcgggaggcacggtgcacctggtggagaaggagacggcctcggacgcggggctgctg
gcggcgtacggacgcaagcacggggtggagggactgaaggtggtcccgacgcacctggag
gcgctgctggcgggagaggacgcccaggcgctgctgccgcgccggaggctggtgctgggc
ggtgacacgtcggagtgggcgctggtggagaaggtgcacgcgctcgcgccggagtgcgag
gtgtacaaccactacggcccgacggagacgacggtgggcgtgctcgcagcgaaggtggag
cgaggggcgcgggtaccgggggcgcagtcggtgccgctgggccggccgctggggaacgtg
cgggtgtacgtgctggacgggtacgagcagccggtggcgccgggagtcccgggcgagctg
tacatcggcggcgagagcgtgggccggggctacctgggccggccggatctgactgcggag
cgcttcgtgccggaccgcttcagcggcgtagctggagcgaggctgtaccggacgggagac
cgggtgcggtggctggaaggaggccgcatcgagttcctgggccgggtggaccaccagttg
aagatccgtggctaccgggtggagctgggcgaggtggaagcggcgttgggccagaatccc
ggcgtgagcgagtgcgtggtggtggcgcgcgaggaagccggaggcaacaagcacctggtg
gcgtacgcggtgggcaggccggggagtacgctggaggagcgagggctgcgcacgtacctg
gaggagcggctgccggactacatggtgcccgcggccttcgtggtgctggagacgctgccg
ttgacgtccaacggaaaggtggaccggaaggcgctgccggcgccgtcgcggagcaaggcg
cgggagacgtacgtggcgccgcgcaccgggacggagcagcggctggcggagctctggcgg
gagctgctcaacgtgccgcgagtgggcgtgcacgacgacttcttcgagctgggcggacac
tcgctgctggcgacgcaggtggtggcgcgggtgggaacgctgttcggggcccagctcgcg
gtcatcgacctgttcgaggcgcccacgctggagaagctggcggcgcgcatcgaggcgggg
agcacgtcggactcgccgctggtgacgctgaggaagggcgggagcggaaggcccttcttc
tgcgtgcacccggtgggcggcagcgtgctggggtacctggagctggcgaggaggctggac
gcggagcagcccttctacggactgcaggtgccggcgagcgggtccggagagacggtggag
gagatggccgcgcgctacctggaagcggtgcgcgaggtgcagcccgagggcccgtacctg
ttgggaggctggtccatgggcgggcgcgtggcgtacgagatggcgagacagctggaagcg
cgaggcgagcgggtggccctgctggccgtcatcgacgcgaggggcagagaggaagcggcg
ggaacggaagcagccccggagacgatggtggagcaggcggtgttcgagttcgccgagcac
ctgtcacggctgtcggggctgcacccgagggcggcggaagtgctcgagcaggtggacgcg
gtggagctgaagtcggtgctggaggggcgagcccatccgctggtggaggaggcggcggcc
gacgaggtgagagcgctgtggcggatgtacgcgcgcaaccggagtgcctcacggacgtac
gagccgaaaccctacggtggcgcactggtgctgctgagggcggcagagggggccgagggc
caggagaaggacctgggttggggcgagctggtgcggggaggagtggaggtgcacgaggta
ccgggcgaccacttcagcctcatcgcgatgccgcacgtggagcacctggccgcacggctg
agggagttgctgaagcgagccgggacaagcggaggcctccagcaggcgggctga

DBGET integrated database retrieval system