KEGG   Archangium gephyra: AA314_04373Help
Entry
AA314_04373       CDS       T03948                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
age  Archangium gephyra
Pathway
age00620  Pyruvate metabolism
age00680  Methane metabolism
age01100  Metabolic pathways
age01120  Microbial metabolism in diverse environments
age01200  Carbon metabolism
Module
age_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA314_04373
  09102 Energy metabolism
   00680 Methane metabolism
    AA314_04373
Enzymes [BR:age01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AA314_04373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 GBP_repeat Lipase_chap
Motif
Other DBs
NCBI-ProteinID: AKJ02747
UniProt: A0A0G2ZRP6
LinkDB All DBs
Position
5389766..5392435
Genome map
AA seq 889 aa AA seqDB search
MPSIRHVDPQLRRDVRLLGRLLGEVLIEQEGQALFDLEERVRRLSIQRRRGPKSERRAAA
SELAALLREMPLERAEPVLRAFSTYFRLANLAEQHHRIRRTREHASGGGQGPQRGSLDAV
MQALKQAGIPASRVREMIVSMRVTLTLTAHPTQAARRTVLQKVYHLARLLEERDRGHLTP
REKADTLESMREEITALWQTDELRRERPTVGDEVKNVLWYVEEVLAEQLALMPETLDWSF
ERAYGEPLGVLATPVRLHSWVGGDMDGNPLVTPEVLADTLRAHRARGLRALLGEVYRLGW
VLTQAEPHAYVSKELRASLEKDAAELPEVMARFGSRTTGEPWRRKLRFMEARLQAALVYV
EGRRAGRTEPLAPTAYRSPMEMLSDLELLERSLVDAKSRHAGLRQVRRLIARVRVMGFHL
AELEARAPAEDARSAAASFDGGPKPTEGGARLLAVLQRVREAQAESGEGCCRTLILSMAS
TAEDVLAAFTCARKSGLWDEARGCATVDVVPLFEQLGALDDGPKVLRELFAHPEYRKHLQ
ARGVQEVMVGYSDSGKEVGLLAASAALYRAQTALTRVAHEAGVQLRLFHGRGETVARGGG
PAHEAILALPPGSVAGTYKATEQGEALDHKYARPELARRTLELVLSGVLLHSLDAQPRVA
SEEEAPFRAAFDELAELGRRAYRGLVWEDPNFVPFFQAATPIEEIAALPIGSRPSKRAAG
GLESLRAIPWVFAWTQNRAILPGWYGVGTALEEYGSRPEGLAQLKRMYRQWPFFHTVMDN
VAMVLAKSDMAIASRYAALAPDSTRPLWERIRAEYARTRRWVKRVTGEARILESNRQLRE
SISLRNPYVDPMSFLQVELLRRKRAGAEKIDRPLLLTLAGIAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgccttccatccgtcacgtggatccgcagctgcgccgggacgtccggctcctgggccgg
ctgctcggcgaagtcctcatcgagcaggagggccaggccctcttcgacctggaggagcgt
gtccggcgcctctccatccagcgccgccgtggcccgaagtccgaacgccgggccgccgcc
tcggagctggccgcgctgctccgggagatgcccctggagcgtgccgagcccgtcctccgc
gccttctccacctacttccggctggccaacctcgccgagcagcaccaccgcatccgccgg
acccgcgagcatgcctccggtggaggccagggcccccagcgcggctcgctcgacgcggtg
atgcaggcgctgaagcaggccggcattcccgcctcgcgcgtccgggagatgatcgtctcc
atgcgggtgacgctcaccctcaccgcgcaccccacgcaggcggcgcgccgcacggtgctg
cagaaggtctaccacctggcgcggctgctcgaggagcgcgaccgcggccacctgacgcct
cgcgagaaggccgacaccctcgagtccatgcgcgaggagatcaccgccctctggcagacg
gacgagctgcgccgcgagcggcccaccgtgggcgacgaggtgaagaacgtcctctggtac
gtggaggaggtgctcgccgagcagctcgcgctcatgccggagacgctcgactggtccttc
gagcgggcctatggcgagccgctgggcgtgctcgccaccccggtgcggctgcactcgtgg
gtgggcggggacatggatggcaatcccctggtgacgccggaggtgctcgcggacacgctg
cgtgcccaccgcgcccgcggcctgcgtgccctgttgggtgaggtgtaccggctgggctgg
gtgcttacccaggccgagccgcatgcctacgtgtcgaaggagctgcgggcctcgctcgag
aaggacgccgcggagctgccagaggtgatggcccgtttcggctcgcgcaccacgggtgag
ccctggcgccgcaagctgcgcttcatggaggcccggctccaggccgctctcgtatacgtc
gagggccgccgtgccggacggaccgagcccctggctcccaccgcctatcgctcgcccatg
gagatgctgagcgacctggagctcctcgagcgctcgctcgtcgacgcgaagtcgaggcat
gccgggttgcggcaggtgcgccggctcatcgcccgggtgcgggtcatgggcttccacctg
gccgagctggaggcgcgcgcgcccgccgaggacgcccggagcgccgccgcgtcgtttgac
ggaggacccaagcccaccgagggcggagcgcggctgctggccgtgctgcagcgggtgcgc
gaggcgcaggccgagtccggtgaggggtgctgccggacgctcatcctgtcgatggcctcc
accgccgaggacgtactcgcggccttcacctgcgcgcgcaagtccggcctgtgggacgag
gcccgcgggtgcgccaccgtggacgtggtgcccctgttcgagcagctcggcgcgctcgat
gacggccccaaggtcctgcgcgagctgttcgcccaccccgagtaccgcaagcacctgcag
gcccgtggcgtgcaggaggtgatggtggggtacagcgactcgggcaaggaggtggggttg
ctggccgccagcgcggcgctctaccgggcccagacggcgctcacccgggtggcacacgag
gcgggcgtgcagctgcggctcttccacggacgcggtgagacggtggcccgcggcggtggt
cccgcgcacgaggccatcctcgcgctcccgcccgggagtgtcgcgggcacgtacaaggcc
accgagcagggcgaggcgttggatcacaagtacgcccggcccgagctggcccggcgcacc
ctggaactggtgctgagcggggtgctgttgcactcgctggatgcgcagccgcgtgtggcg
tccgaggaggaggccccattccgcgccgccttcgacgagctggcggagctgggccgccgt
gcctaccgggggctcgtctgggaggacccgaacttcgtgccgttcttccaggcagccacg
cccatcgaggagatcgccgcgctgcccatcggctcgcggccgagcaagcgtgccgcggga
ggactggagtccctgcgtgccattccgtgggtgttcgcctggacgcagaaccgagccatc
ctgccggggtggtacggcgtgggcacggcgctggaggagtacggctcgcggcccgagggc
ctcgcgcagctcaagcgcatgtaccgccagtggcccttcttccacaccgtgatggacaac
gtggcgatggtgctcgccaagtcggacatggccatcgcgtcgcgctacgcggcgctggcg
ccggactccacgcgcccgttgtgggagcgcatccgcgccgaatacgcacgtacccgccgc
tgggtgaagcgcgtgacgggggaggcgcgcatcctggagagcaaccggcaattgcgcgag
agcatctccctgcgcaatccgtacgtggaccccatgtccttcctccaagtggagctgctg
cggcgcaagagggcgggggcggagaagatcgatcgcccgctgctgctcacgctggccgga
atcgccgcgggcatgcgcaacacggggtga

DBGET integrated database retrieval system