KEGG   Archangium gephyra: AA314_04924Help
Entry
AA314_04924       CDS       T03948                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
age  Archangium gephyra
Pathway
age00473  D-Alanine metabolism
age00550  Peptidoglycan biosynthesis
age01100  Metabolic pathways
age01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA314_04924
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA314_04924
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AA314_04924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:age01011]
    AA314_04924
Enzymes [BR:age01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AA314_04924
Peptidoglycan biosynthesis and degradation proteins [BR:age01011]
 Precursor biosynthesis
  Amino acid ligase
   AA314_04924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AKJ03298
UniProt: A0A0G2ZNU5
LinkDB All DBs
Position
6112413..6113438
Genome map
AA seq 341 aa AA seqDB search
MALPPLRIAVLHYQAKDDPPDAVMEQVCATLQQLGHTPVPVRVDESLSDMVRQVSRSGAD
LVFNLCETFAEDYRFDVNVAAVLELARVPFTGSGTAGLLLAQDKILTKQLLQFHGVLTPR
FASFDGDSFQTNGDLSFPLIVKPARSDASMGLGVEKDMEGLARRVRMIREQYDDEALAEE
FIEGRELYVGVLGDHSRPEVLPVVELDFGKKWSRKRMKIADREVKFGPDTPGSPQLVLPR
DLSDELRGRIEGAAVTAFRALKLRDYARIDFRVSSATNEPYLLEVNPNPYLEEKSEVALA
ARDKGMSYPALIQHIVEVAARRYGLGRGAAQAAPAEEPLST
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccgccccttcgcatcgcggtccttcactaccaggccaaggatgatccgccg
gatgcggtgatggagcaggtgtgcgccacgctccagcagctcggacacacgccggtgccg
gtgcgcgtggacgagagcctctcggacatggtgcggcaggtgtccaggtcgggcgccgac
ctcgtcttcaacctctgcgagaccttcgccgaggactaccggttcgatgtgaacgtcgcc
gcggtgctggagctcgcgcgcgtgcccttcacgggctcggggacggcgggcctgctgctc
gcccaggacaagatcctcaccaagcagctgctgcagttccacggggtgctcaccccgcgc
ttcgcctccttcgacggcgactcgttccagacgaatggagacctgtcctttccgctcatc
gtcaagcccgcgcgctcggacgcctccatggggctgggcgtggagaaggacatggagggg
ctggcgcgccgcgtgcggatgattcgcgagcagtatgacgacgaggcgctcgcggaggag
ttcatcgaggggcgggagttgtacgtgggcgtgctcggcgatcactcccggcccgaggtg
cttcccgtggtggagctcgacttcggaaagaagtggagccgcaaacgcatgaagatcgcg
gaccgggaggtgaagttcgggccggatacgcccgggagcccccagctcgtgctgcccagg
gacttgtcggacgagctgcggggccgcatcgagggagccgcggtgacggccttccgcgcg
ctcaagctgcgcgactacgcccgcatcgacttccgcgtgtccagcgccaccaacgagccc
tacctcctcgaggtgaaccccaacccgtacctcgaggagaagagcgaggtggcgctcgcg
gcccgggacaagggcatgtcgtatccggcgctcatccagcacatcgtcgaggtggccgcg
cgccgttacgggctcgggagaggggcggcccaggccgcgcccgccgaggagcccctgtcc
acgtag

DBGET integrated database retrieval system