KEGG   Archangium gephyra: AA314_05130Help
Entry
AA314_05130       CDS       T03948                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
age  Archangium gephyra
Brite
KEGG Orthology (KO) [BR:age00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:age01002]
    AA314_05130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:age04147]
    AA314_05130
   04090 CD molecules [BR:age04090]
    AA314_05130
Enzymes [BR:age01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AA314_05130
Peptidases [BR:age01002]
 Metallo Peptidases
  Family M2
   AA314_05130
Exosome [BR:age04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AA314_05130
CD molecules [BR:age04090]
 Proteins
  AA314_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 CENP-O
Motif
Other DBs
NCBI-ProteinID: AKJ03504
UniProt: A0A0G2ZXN7
LinkDB All DBs
Position
6382011..6383921
Genome map
AA seq 636 aa AA seqDB search
MNSTSPVKSLVRAALVVVPLIASPGCTPSAHGSTAGSSEEARTAAPAAEPQKSAEAAQPT
AEDARQFATRVNEDLKRLWTRQATADWIKSTYITDDTERNAAVVNEEVLAYVSQAIKEAA
RFKDVQGLDADTSRTLHLLRVSSTLPAPSDAQKRAELAAIASKLDGLYGKGKYCGKDGKG
QCKDLGDLSDVMAKSRNYDELLEAWTGWHTISTPMRPLYQRLVQLSNEGAQEIGFADTGA
LWRSNYDMPPEAFEKEAQRLWGQVKPLYDDLHCYVRARLAKQYGEDKVPAGKAIPAHLLG
NMWSQEWNNIYSMVEPYKGQPSLDVDAELKRQNYDALRMVKLGESFFTSLGLKPLPETFW
QRSQFTKPRDREVMCHASAWDITYDNDVRIKMCIKPTEEDLVTIHHELGHDYYYTYYYKL
PVLYQSGAHDGFHEAIGDALTLSITPGYLKQLGLLKEVPKGDKGLINLQMKDAMEKVAFL
PFGLLVDQWRWDVFSGRVKPEDYNKAWWALREKYQGVRAPVERTENDFDPGAKYHVPSNV
PYTRYFLARILQFQFHRALCQAAGQKGALHECSIYGNKEAGQRLQAMLEMGASKPWPDAL
QALTGQREMDASAMLEYFAPLRTWLQEQNKGQKCGW
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcacctctcccgtcaagtccctcgtgcgtgcggccctcgtggtcgtcccgctc
atcgcttctcctggctgtacgccctcggcgcatggctccaccgctggctcttccgaggag
gcgcgcaccgccgcgcccgccgcggagccgcagaagtccgccgaggccgcgcagcccacg
gccgaggacgcacgccagttcgccacccgcgtgaacgaggatctcaagcgtctgtggacg
cgccaggccacggccgactggatcaagtccacgtacatcaccgatgacaccgagcggaac
gcggccgtcgtcaacgaggaggtgctggcctacgtcagccaggccatcaaggaggccgcg
cgcttcaaggacgtacagggcctggacgcggacacctcgcgcacgctgcacctgctgcgg
gtgtcctccacgctgcccgcgccgagcgatgcgcagaagcgcgcggagctggccgccatc
gcctcgaagctcgatggcctctatggcaagggcaagtactgcggcaaggacggcaagggt
cagtgcaaggacctgggcgatctgtccgatgtgatggccaagagccgcaactacgacgag
ctgctggaggcgtggacgggctggcacaccatctcgacgccgatgcgcccgctctaccag
cggctggtgcagctctccaacgagggcgcccaggagatcggcttcgcggacacgggcgcg
ctctggcgctccaactacgacatgcctcccgaggccttcgagaaggaggcccagcggctg
tgggggcaggtgaagcccctctatgacgacctgcactgctacgtgcgcgcccggctggcg
aagcagtacggcgaggacaaggtgcccgccggcaaggccatccccgcgcacctgctcggc
aacatgtggtcccaggagtggaacaacatctacagcatggtggagccctacaagggccag
cccagcctggacgtggatgccgagctgaagcggcagaactacgacgccctccgcatggtg
aagctgggtgagagcttcttcacctcgctggggctcaagccgctcccggagacgttctgg
cagcgctcgcagttcaccaagccgagggaccgcgaggtgatgtgccacgccagcgcctgg
gacatcacctacgacaacgacgtgcgcatcaagatgtgcatcaagcccaccgaggaggat
ctggtcaccatccaccacgagctgggccacgactactactacacgtactactacaagctt
ccggtgctctatcagtccggcgcgcatgacggcttccacgaggccatcggtgatgcgctc
accctctccatcaccccgggctacctcaagcagctgggtctgctgaaggaggtccccaag
ggagacaagggcctcatcaacctgcagatgaaggacgccatggagaaggtggccttcctg
cccttcggcctgttggtggatcagtggcgctgggatgtcttctccgggcgggtgaagccg
gaggactacaacaaggcctggtgggcgctgcgcgagaagtaccagggcgtgcgcgcgccg
gtggagcgcaccgagaacgacttcgatccgggcgccaagtaccacgtcccctccaacgtc
ccctacacgcgctacttcctggcgcgcatcctccagttccagttccaccgcgcgctctgc
caggccgcgggccagaagggggccctccacgagtgctccatctacggcaacaaggaggcc
ggtcagcggctccaggccatgctggagatgggtgccagcaagccctggcccgatgcgctc
caggctctcaccggccagcgggagatggatgcctcggcgatgctggagtacttcgccccg
ctgcgcacctggctgcaggagcagaacaagggccagaagtgcgggtggtag

DBGET integrated database retrieval system