KEGG   Archangium gephyra: AA314_05144Help
Entry
AA314_05144       CDS       T03948                                 

Definition
(GenBank) Uracil-DNA glycosylase, family 5
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
age  Archangium gephyra
Pathway
age03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:age00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AA314_05144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:age03400]
    AA314_05144
Enzymes [BR:age01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     AA314_05144
DNA repair and recombination proteins [BR:age03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AA314_05144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Rpn9_C
Motif
Other DBs
NCBI-ProteinID: AKJ03518
UniProt: A0A0G2ZPH4
LinkDB All DBs
Position
6396012..6396737
Genome map
AA seq 241 aa AA seqDB search
MAKSKATGTAGAAGLARLHEEIITCRACPRLVEWREQVAREKRRAFRDWTYWGRPVPGFG
DPQAELVILGLAPAAHGANRTGRVFTGDRSGDFLFAGLHRAGFANQPRSEHRDDGLALTG
AYIVAPCKCAPPDNKPLPEELVRCAPFLDREMALLPGRVVLTLGGIAWNATLAWLERAGV
SIPTPRPSFGHGAELALPGAPVLLGCYHVSQQNTQTGRLTPAMFDAIMARARVLIENRRG
T
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagagcaaggcgacagggacggcaggcgcggcggggctcgcgcgccttcacgag
gagatcatcacctgccgggcgtgtccccggttggtggagtggcgcgagcaggtggcgcgg
gagaagcgccgggccttccgcgactggacgtactggggccggcccgtgcccggcttcggg
gacccccaggcggagctggtcatcctcggactggcgccggcggcacatggggccaaccgg
acgggccgggtgttcaccggggatcgctcgggggacttcctgttcgccgggctgcaccgg
gcgggcttcgccaaccagccccggagcgagcaccgggacgacggcctcgcgctgacgggg
gcctacatcgtcgcgccgtgcaagtgcgcgccgccggacaacaaacccctgccggaggag
ctggtccggtgtgctcccttcctggaccgggagatggccctgctgcccggccgggtggtc
ctgacgctggggggcattgcctggaacgcgacgctcgcctggctggagagggcgggggtg
tccattcccacgccccggccgtccttcggacacggagcggagctggccctgccgggggcg
ccggtgctcctgggctgctaccacgtgagccagcagaacacgcagacgggccggctcacc
cccgccatgttcgacgcgatcatggcccgggcccgggtgctgatcgaaaatcgccgggga
acatga

DBGET integrated database retrieval system