KEGG   Archangium gephyra: AA314_07750Help
Entry
AA314_07750       CDS       T03948                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
age  Archangium gephyra
Pathway
age00010  Glycolysis / Gluconeogenesis
age00052  Galactose metabolism
age01100  Metabolic pathways
age01110  Biosynthesis of secondary metabolites
age01120  Microbial metabolism in diverse environments
age01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:age00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA314_07750
   00052 Galactose metabolism
    AA314_07750
Enzymes [BR:age01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AA314_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AKJ06124
UniProt: A0A0G3A541
LinkDB All DBs
Position
complement(9705879..9706943)
Genome map
AA seq 354 aa AA seqDB search
MERTPFGTAPGGQPVEVYTLTNRQGVEARVTNYGGIILGLRVPDRHGRFDDVVLGYDSLA
GYLAESPYFGALVGRYGNRIARGRFTLDGQPYTLATNNGVNHLHGGLKGFDKVVWTAAPF
ENDQGMGLVLTYVSPDGEEGYPGTLTARVTYTLTGDNALVFDYHATTDKATPVNLTQHSY
FNLAGDGKGDILGHVVTLNADRFVPIDPTSIPLGELRDVTGTPFDFRRPIAIGARIGQED
EQLRNGQGYDHCVVLDKGGKAGELTLAAHVLEPTTGRVMEIHTTEPGMQFYSGNFLDGSL
KGKKGAVYHHRHGFAMETQHFPDSPNQPSFPSTILRPGEHYRSRSVYRFSVSGS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggaacggactcccttcggtacggcccctggcggacagcccgttgaggtctacaccctc
accaacaggcagggggtcgaggcacgggtcaccaattacggcggaatcatcctcggcctg
cgcgtgccggacaggcacggccgtttcgacgacgtggtgctgggctacgactcactggcc
ggttacctggcggagtccccgtatttcggcgcgctggtcggccgctatggcaaccgcatc
gcccggggccggttcacgctcgatggccagccctacaccctggcgacgaacaacggggtg
aatcacctgcacggcgggctcaagggcttcgacaaggtggtgtggaccgcggcgcccttc
gagaacgaccagggcatggggctcgtcctcacctacgtcagccccgacggcgaggagggc
tacccgggcaccttgaccgcgcgggtcacctatacgctgaccggcgacaacgcgctcgtc
ttcgactaccacgccaccaccgacaaggcgacgccggtcaacctcacgcaacacagctat
ttcaacctggccggagacgggaagggcgacatcctgggccatgtcgtcacgctcaacgcg
gaccgcttcgttccgattgatccaacgtccatccccctgggcgagctccgcgacgtcacg
ggcacgccgttcgacttcaggcggcccatcgccatcggtgcgcgcatcggccaggaggac
gagcagctgcgcaacgggcagggctatgaccactgcgtcgtgctcgacaaggggggcaag
gctggcgagctgacgctggccgcgcacgtcctggagcccaccaccggccgcgtgatggag
atccacaccaccgagccgggcatgcagttctactccggcaactttctcgacggctcgctg
aaggggaagaagggcgcggtctatcaccaccgccacggcttcgcgatggagacccagcac
ttcccggactctccaaaccagccctcctttccctcgacgattcttcgtcctggcgagcat
taccgctcgcgctccgtctacagattctcggtctcgggttcgtga

DBGET integrated database retrieval system