KEGG   Agromyces sp. FW100M-8: ET445_01570Help
Entry
ET445_01570       CDS       T05835                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
agf  Agromyces sp. FW100M-8
Pathway
agf00250  Alanine, aspartate and glutamate metabolism
agf00280  Valine, leucine and isoleucine degradation
agf00310  Lysine degradation
agf00410  beta-Alanine metabolism
agf00640  Propanoate metabolism
agf00650  Butanoate metabolism
agf01100  Metabolic pathways
agf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:agf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ET445_01570 (gabT)
   00650 Butanoate metabolism
    ET445_01570 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ET445_01570 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ET445_01570 (gabT)
   00310 Lysine degradation
    ET445_01570 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ET445_01570 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:agf01007]
    ET445_01570 (gabT)
Enzymes [BR:agf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ET445_01570 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ET445_01570 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ET445_01570 (gabT)
Amino acid related enzymes [BR:agf01007]
 Aminotransferase (transaminase)
  Class III
   ET445_01570 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QAY72222
UniProt: A0A4P6F8Q2
LinkDB All DBs
Position
complement(341601..342989)
Genome map
AA seq 462 aa AA seqDB search
MTLTEPTTTPAATPAPTALVGGPALPQERRLVTAIPGPRSQELIARKSAAVAAGVGHTLP
ISVVAAGDGVVVDADGNSLIDLGSGIAVTGVGNSNPRVVAAVAAQLEAFTHTCFTIAPYE
GYVAVAEKLNALTPGDHVKRSALFNSGAEAVENAIKIARNFTKKQAVVAFDHAYHGRTNL
TMGLTAKNIPYKSGFGPFAPEIYRAPLSYPFRDGGLSGAEAAARAITQIEKQVGAENLAA
IIIEPIQGEGGFIVPAQGFLPALAAWARDNDVVFIADEVQTGFARTGAWFASEHEGIVPD
LVVTAKGIAGGLPLSAVTGRAEIMDSSMAGGLGGTYGGNPLATAAALATIEAYEEDGLVE
RAKQIGALLLGRLNALRTADPRIGDVRGRGAMVAIELVDPETGAPDAALTSKIAAYAHAN
GVILLTCGTYGNVIRFLPPLTISDELLVEGVGVVAEALRGAH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaccgagcccacgacgacgcccgccgcgacgcccgcgccgaccgccctcgtc
ggcggccccgccctcccgcaggagcgccgcctcgtcactgcgatcccgggcccgcgctcg
caggagctcatcgcccgcaagtccgccgcggtcgccgcgggcgtcggccacacgctgccg
atctcggtcgtcgccgcgggcgacggcgtcgtcgtcgacgccgacggcaactcgctcatc
gacctcggctcgggcatcgccgtgacgggcgtcggcaactcgaacccgcgcgtcgtcgcc
gccgtcgcggcccagctcgaggcgttcacgcacacgtgcttcacgatcgcgccctacgag
ggctacgtcgccgtcgccgagaagctcaacgcgctcacgccgggcgaccacgtcaagcgc
tccgcgctcttcaactcgggcgccgaggccgtcgagaacgccatcaagatcgcccgcaac
ttcaccaagaagcaggccgtcgtcgcgttcgaccacgcctaccacggccgcacgaacctc
acgatgggcctcacggccaagaacatcccgtacaagagcggcttcggcccgttcgctccc
gagatctaccgcgcccccctctcgtatccgttccgcgacggcggcctctcgggcgccgag
gccgcggcccgcgcgatcacgcagatcgagaagcaggtcggcgccgagaacctcgccgcg
atcatcatcgagcccatccagggcgagggcgggttcatcgtgcccgcccagggcttcctc
cccgcgctcgccgcgtgggcgagggacaacgacgtcgtcttcatcgccgacgaggtgcag
accgggttcgcgcgcacgggcgcgtggttcgcgagcgagcacgagggcatcgtgcccgac
ctcgtcgtgaccgcgaagggcatcgcgggcggcctgccgctctcggccgtcacgggccgc
gccgagatcatggactcgtcgatggcgggcggcctcggcggcacgtacggcggcaacccg
ctcgcgaccgccgccgcgctcgcgacgatcgaggcctacgaggaagacggcctcgtcgag
cgtgcgaagcagatcggcgcgctcctcctcggacgcctgaacgcgctccgcacggccgac
ccccggatcggcgacgtccgcggacgcggcgcgatggtcgcgatcgagctcgtcgacccc
gagaccggcgcgcccgacgccgccctcacctcgaagatcgccgcctacgcgcacgcgaac
ggcgtgatcctcctcacgtgcggcacgtacggcaacgtcatccgcttcctcccgccgctc
acgatctccgacgagctgctcgtcgagggcgtcggggtggtcgccgaggcgctccgcggc
gcacactga

DBGET integrated database retrieval system