KEGG   Agromyces sp. FW100M-8: ET445_08290Help
Entry
ET445_08290       CDS       T05835                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
agf  Agromyces sp. FW100M-8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: QAY73344
LinkDB All DBs
Position
1768658..1769728
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVAPMLSKAVKEIPDTGHVEPKWDGFRTIVFRDGDEVELGSRNEKPMTRYFPE
LVEELKRNLPPRIVVDGEIVLERGGRLDFDALQQRIHPAASRVKLLSEQTPASFIAFDLL
ALGDDDLTGRPFVERRRLLEQALAEASDPVFITPATADLAVARDWFERFEGAGLDGVVAK
PLDGTYQPDKRTMFKIKHERTADCVVAGYRWYKTGDVVGSLLLGLYDGEGRLHHVGVAAS
FTMARRRELVDELAPYVATDASEHPWGEWAFPEAHAETRMPGAVSRWSAGKDLSFVPLRP
ELVVEVAYEHLEGDRFRHTARFRRWRPDRDPASCTYAQLDEAEPFELAEILPIRGR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacctccccgtcatgccgcccgtcgcgcccatgctgtcgaaggccgtcaaggagatc
cccgacacggggcacgtcgagccgaagtgggacggcttccgcacgatcgtcttccgcgac
ggcgacgaggtcgaactcggcagccgcaacgagaagcccatgacgaggtacttccccgaa
ctcgtcgaagagctcaagcgcaacctcccgccccgcatcgtcgtcgacggcgagatcgtg
ctcgaacgcggcggacgcctcgacttcgacgcgctccagcagcgcatccaccctgcggcg
agtcgcgtgaagctcctttccgagcagacgccggcgtcgttcatcgcgttcgacctcctc
gccctcggcgacgacgacctcacgggacgtccgttcgtcgagcggcggagactgctcgaa
caggcgctcgccgaggcatccgaccccgtcttcatcacccccgcgacggccgacctcgcg
gtcgcccgcgactggttcgagcgcttcgagggcgcgggcctcgacggcgtcgtcgcgaaa
cccctcgacggcacctaccagcccgacaagcgcacgatgttcaagatcaagcacgagcgc
acggccgattgcgtcgtcgcgggctaccgctggtacaagacgggggatgtcgtggggtcg
ctgctgctcggcctgtacgacggcgaggggcggctccatcacgtgggcgtcgcggcgtcg
ttcacgatggcgcggcggcgcgagctcgtcgatgaactcgcgccgtatgtcgcgacggat
gcctcggagcacccgtggggcgaatgggcgttccccgaggcgcacgccgagacccggatg
ccgggcgctgtcagccggtggagcgcggggaaagacctctcgttcgtgccgctgcggccc
gagctcgtcgtggaggtcgcgtacgagcacctcgagggcgaccggttccggcacactgcg
cggttccgccgctggcggcccgaccgcgaccccgcgagctgcacctacgcgcaactcgac
gaggccgagccgttcgagctcgccgagatcctgccgatccgggggcggtag

DBGET integrated database retrieval system