KEGG   Agromyces sp. FW100M-8: ET445_10865Help
Entry
ET445_10865       CDS       T05835                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
agf  Agromyces sp. FW100M-8
Pathway
agf00473  D-Alanine metabolism
agf00550  Peptidoglycan biosynthesis
agf01100  Metabolic pathways
agf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:agf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ET445_10865
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ET445_10865
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ET445_10865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:agf01011]
    ET445_10865
Enzymes [BR:agf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ET445_10865
Peptidoglycan biosynthesis and degradation proteins [BR:agf01011]
 Precursor biosynthesis
  Amino acid ligase
   ET445_10865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: QAY73772
UniProt: A0A4P6FCI9
LinkDB All DBs
Position
2342657..2343748
Genome map
AA seq 363 aa AA seqDB search
MAKLRVALLFGGRSSEHSISCATAGGVLSAIDRDRFEVIPVGITRDGAFVLEQNDPARFG
LDPDRLPEVVDNGTRVRWPESTASRELSVTDASGERSLGDVDVVFPILHGRFGEDGTIQG
LFELVGLPYVGNGVLASAIAMDKHVAKTVLEGAGLAVAPWVTLTRAAWDDDRDLWERRVH
SLGLPAFVKPARAGSSVGVTKVSDWAELPAALDVAFAEDRTVLVEEAIVGREIEVAVLEG
RDGTGPRVSVAGEIVVTGREFYDFEAKYLDADGVELVCPAELGDGELFELQRVARRAFEA
IGGEGLARVDVFLTGEGYVVNEVNTLPGFTPISMFPTCWLNSGLSYPELITELVEVGHAR
GAR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctcagagtggcactgctgttcggagggcgctccagcgagcattcgatcagc
tgcgccacggcgggcggagtcctgagcgcgatcgaccgtgaccggttcgaggtgatcccc
gtcgggatcacccgcgacggcgcttttgtgctggagcagaacgaccccgcgcgcttcggc
ctcgaccccgaccggcttcccgaggtcgtcgacaacggcacgcgcgtgcgttggcccgag
tcgacggcgtcgcgtgaactcagtgtgacggatgcctcaggcgagcgctcgctcggagac
gtcgacgtcgtcttcccgatcctgcacggccggttcggcgaggacggcacgatccagggc
ctcttcgagctcgtgggtctgccgtacgtcggcaacggcgtgctggcgtcggcgatcgcg
atggacaagcacgtcgcgaagacggtgctcgagggcgccgggctcgcggtcgcgccgtgg
gtgacgctcacgcgcgcggcgtgggacgacgaccgcgacctgtgggagcgccgcgtgcac
tcgctcggccttccggcattcgtgaagcccgcccgcgcgggatcgtcggtcggcgtcacg
aaggtctccgattgggccgagcttccggccgcgctcgacgtcgcgttcgccgaggaccgc
acggtgctcgtcgaagaggcgatcgtcggtcgcgagatcgaggtcgccgtgctcgaagga
cgtgacggcaccgggccgcgcgtgagcgtcgcgggcgagatcgtcgtgaccggccgcgag
ttctacgacttcgaggcgaagtacctcgacgccgacggcgtcgagctcgtctgccccgcc
gaactcggcgacggcgagctcttcgaactgcagcgcgtcgcgcgtcgcgcgttcgaggcg
atcggcggcgaggggctcgcccgcgtcgacgtgttcctgacgggcgagggctacgtcgtc
aacgaggtcaacacgctgccgggcttcacgcccatctcgatgttcccgacgtgctggctc
aactcgggcctcagctaccccgagctcatcaccgagctcgtcgaggtcgggcacgcgcgc
ggagcgcggtag

DBGET integrated database retrieval system