KEGG   Agrococcus sp. SGAir0287: C1N71_12605Help
Entry
C1N71_12605       CDS       T05973                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
agg  Agrococcus sp. SGAir0287
Pathway
agg00071  Fatty acid degradation
agg00410  beta-Alanine metabolism
agg00592  alpha-Linolenic acid metabolism
agg00640  Propanoate metabolism
agg01040  Biosynthesis of unsaturated fatty acids
agg01100  Metabolic pathways
agg01110  Biosynthesis of secondary metabolites
agg01200  Carbon metabolism
agg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:agg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C1N71_12605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C1N71_12605
   00592 alpha-Linolenic acid metabolism
    C1N71_12605
   01040 Biosynthesis of unsaturated fatty acids
    C1N71_12605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1N71_12605
Enzymes [BR:agg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     C1N71_12605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N DSHCT
Motif
Other DBs
NCBI-ProteinID: QCR20174
UniProt: A0A4P8RIQ7
LinkDB All DBs
Position
complement(2639256..2641355)
Genome map
AA seq 699 aa AA seqDB search
MEESVVDTLSASQPLEVEETHAPLDLEPAPRRARIDVDWLGRDLLGTWAERRLAARAKAA
NPAYQRIPNQTMEEHRERVLGQLRMLVDDGAVLVAFPKELGGEDDHGGNIAGFEELVLAD
PSLQIKSGVQYGLFGAAVLHLGTTDHHERLLPPIMRFDVPGAFAMTETGHGSDVASIGTT
ATYDEATEEFVIHTPFRGAWKDYLGNAAKDGVAAVVFAKLVTKGVDHGVHAFYVDIRDPE
TGEFLPGVGGEDDGFKGGLNGIDNGRLHFDHVRVPRRNLLNRYGDVAADGTYSSSIESPG
RRFFTMLGTLVQGRVSLDGASAVASKAALAIAIRYGAERRQFQASSDVEEEVLLDYRRHQ
KRLFTRLAETYAMSYAHERLLTEFDGVFSGETDTPEAREDLETLAAGLKALSTWAALDTL
QEAREACGGQGFLAENRLTMLRQDMDVYATFEGDNTVMLQLVGKRLLGDFAKQFKGASAA
QLAQFAAKEFAGRAAAQVGLHVVAQDVRDLRQPATASRALRTTAVQRELLTDRVETMVAE
IGGRLRHVPRGDAAKTAKAFNNVQNELIEAARAWAELQQWKALTEAVERMSGETARVMTW
VRDLFALTLLERHLAWYLANGRLSGSRAKVVTSTIERLLVKIRPHALDLVDAFGLGDELL
RAPIASGVEGQRQAEAMAYYEAHRAAGTLPTPEKQAKRR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatcggtggtcgacaccctgtccgcatcccagccgctcgaggtcgaggagacg
cacgcgcccctggatctcgagcccgcgccgcgccgcgcccgcatcgacgtggactggctc
ggccgcgacctgctcggcacgtgggccgagcgtcgcctcgccgcacgcgcgaaggccgcg
aaccccgcctaccagcgcatcccgaaccagacgatggaggagcaccgcgagcgcgtgctc
ggccagctgcggatgctcgtcgacgacggcgccgtgctcgtggccttcccgaaggagctc
ggcggcgaggacgaccacggcggcaacatcgccggcttcgaggagctcgtgctcgccgac
ccctcgctgcagatcaagtccggcgtgcagtacgggctcttcggcgccgccgtgctgcac
ctcggcacgaccgaccaccacgagcggctgctgccgcccatcatgcgcttcgacgtgccc
ggcgccttcgcgatgaccgagacggggcacgggtcggacgtcgcgtcgatcggcacgacc
gcgacctacgacgaggcgacggaggagttcgtcatccacacccccttccgcggcgcgtgg
aaggactacctcggcaacgccgcgaaggacggcgtcgcggcggtcgtgttcgcgaagctc
gtcacgaagggcgtcgaccacggcgtccacgcgttctacgtcgacatccgcgaccccgag
accggcgagttcctgcccggcgtcggcggcgaggacgacggcttcaagggcggcctcaac
ggcatcgacaacggtcggctgcacttcgaccacgtgcgcgtgccgcgccgcaacctgctg
aaccgctacggcgacgtcgccgccgacggcacctactcgtcgtcgatcgagagcccggga
cgccgcttcttcacgatgctcggcacgctcgtgcagggccgcgtctcgctcgacggcgcc
tcggcggtggcgtcgaaggcggcgctcgcgatcgcgatccggtacggcgccgagcgtcgc
cagttccaggcgtcgagcgacgtcgaggaggaggtgctgctcgactaccgcaggcaccag
aagcgcctgttcacgcgcctcgccgagacgtacgcgatgtcgtacgcccacgagcggctg
ctcacggagttcgacggcgtcttctcgggcgagaccgacaccccggaggcgcgcgaggac
ctcgagacgctcgccgccggcctcaaggcgctctcgacctgggctgcgctcgacacgctg
caggaggcgcgcgaggcgtgcggcggccaaggcttcctcgccgagaaccggctgacgatg
ctgcgccaggacatggacgtctacgcgacgttcgagggcgacaacaccgtgatgctgcag
ctcgtcggcaagcgcctgctgggcgacttcgccaagcagttcaagggtgcgtccgccgcg
cagctcgcgcagttcgctgcgaaggagttcgccggacgtgccgcggcgcaggtcggcctc
cacgtcgtcgcgcaggacgtgcgcgacctgcggcagccggcgacggcgtcccgcgccctg
cgcacgaccgcggtgcagcgcgagctgctcacggaccgcgttgagacgatggtcgccgag
atcggtgggcgcctgcgccacgtgccgcggggcgacgccgcgaagaccgcgaaggcgttc
aacaacgtgcagaacgagctcatcgaggccgcacgggcctgggccgagctgcagcagtgg
aaggcgctgacggaggccgtcgagcggatgtcgggcgagacggcgcgcgtcatgacgtgg
gtgcgcgacctcttcgcgctcacgctgctcgagcggcacctcgcctggtacctcgcgaac
ggtcgcctctcgggctcgcgtgcgaaggtcgtgacgtcgaccatcgagcgactgctcgtg
aagatccgaccgcacgcgctcgacctcgtcgacgccttcggcctcggcgacgagctgctg
cgcgccccgatcgcgtcgggggtcgagggccagcggcaggcggaggcgatggcgtactac
gaggcgcaccgcgccgccggcacgctgccgacgcccgagaagcaggcgaagcgccgctga

DBGET integrated database retrieval system