KEGG   Arachidicoccus ginsenosidivorans: FSB73_07905Help
Entry
FSB73_07905       CDS       T06150                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
agi  Arachidicoccus ginsenosidivorans
Pathway
agi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:agi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FSB73_07905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:agi02000]
    FSB73_07905
Enzymes [BR:agi01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     FSB73_07905
Transporters [BR:agi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    FSB73_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_15 RsgA_GTPase AAA_22 AAA_16 Rad17 AAA_29 SMC_N AAA_25 ATPase_2 PduV-EutP AAA_14 AAA_18 AAA NACHT AAA_28 ABC_ATPase BCA_ABC_TP_C Rad51 AAA_30 AAA_5 AAA_24 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: QEC71599
UniProt: A0A5B8VJU5
LinkDB All DBs
Position
complement(1948567..1949421)
Genome map
AA seq 284 aa AA seqDB search
MSNSSTIIDQVQQVNGGEAGATSGAFPNTSVQTSDSPILQIRDFNVQAGDTRILKDIHLD
IPKGKITVLLGPSGCGKTTLLKCLNRLSDLHPSLKVKGQILIDGEDIFHPTQDLTTIRQK
MGLLSQRPFPLPMSIYKNIAYGLKIKGIRDKKVVKEKVEKHLRDVGLWEEVKDRLHGPAA
RLSIGQQQRLCLARGLAVGPEIILADEPTSALDPISSRKIEEEFLRLKEDYTLIVVTHIL
RQAKRLADHIVFMYFGEIIEQGTPDEIFNHPKSDILKQYLQSGH
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatagttcaaccataatagatcaggtgcaacaggtgaatgggggcgaggcaggt
gccacttctggagcctttccaaatacctccgttcaaacgtccgattcaccgattttacaa
atcagggattttaatgttcaggcaggggataccagaatattgaaagatatccatttggat
atcccaaaagggaaaataacggttttattaggtccatcaggttgcggcaagactactttg
ctgaaatgcctaaacagattatctgatttgcatccgagtctgaaggtaaaggggcagatt
ttaattgatggggaggatatttttcacccaacgcaggatttgacgacaattcgccagaaa
atgggcttattgtctcaaaggccattcccattgccgatgtctatttacaagaatattgcc
tatggtctgaaaataaaggggattagggacaaaaaggtagtaaaagagaaggtggagaag
catttaagggatgtggggctatgggaagaggtgaaagatcgtttgcatgggccagctgcc
aggctatccattggtcaacagcaaaggctctgcctggccagagggctggctgtaggccct
gaaatcatactggcggatgaacccacttctgccctggatcctatttccagtagaaagatt
gaagaagaatttttaagattaaaggaggattatactttgatagttgttactcatatactt
agacaggcaaaaaggctggccgatcatattgtctttatgtattttggggagatcattgaa
caggggacgcctgatgagatattcaaccatcctaaatcagatatattaaaacagtattta
caaagcggacattag

DBGET integrated database retrieval system