KEGG   Akkermansia glycaniphila: PYTT_0507Help
Entry
PYTT_0507         CDS       T04551                                 

Definition
(GenBank) invasin/intimin cell-adhesion fragments
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
agl  Akkermansia glycaniphila
Pathway
agl00052  Galactose metabolism
agl00511  Other glycan degradation
agl00600  Sphingolipid metabolism
agl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PYTT_0507
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PYTT_0507
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PYTT_0507
Enzymes [BR:agl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PYTT_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 F5_F8_type_C Glyco_hydro_2 Glyco_hydro_2_N Invasin_D3 fn3_5
Motif
Other DBs
NCBI-ProteinID: SEH75953
UniProt: A0A1H6KQ32
LinkDB All DBs
Position
I:623916..626945
Genome map
AA seq 1009 aa AA seqDB search
MRAYYRNPAPIVSHHIHMKTHWTLLLTLGISVANAAPLPATQRETFDFGWKHARFGNMPD
GTVQPEPGAESAPLTSSSHEHQNIAMNAMDGNRNTRWCAANANPGHYITADFGKPVAVSQ
INVIWEKAAPRDYVISGSDNGKTWTDIAARIGDNGTESAQNLYGKNQKPADSRAYRYYKF
TVNGTGGGNWASIREIEFTDAAGKKIKPAGEKLNANKVPFGTNFDDTKWRSLNLPHDWAI
EGPFRPELENETGKLPWVGIGWYRKSFDVPADAGEHRYYLDFDGVLSMPKVYVNGELAGE
WGYGYSSFRVDISKHLKPGQKNTVAVRAENLPRSSRWYPGAGIYRHVWLTKTNPVHVDNW
GVSITTPQVSNDRATVEIKTTVLNTSDKPATVSVENAVAGVAGAAGKPETVTIPAGQSKE
ITSTIQLGNPKLWDLDTPHLYDLATTIKLDGKIIDKVNNTFGVRTVEWKPDGFYLNGRKV
RINGVCQHHDLGPLGAAVYARGYERQLEILKEMGVNSIRTSHNPPAPELLEACDRMGILV
DNELFDIWEHQKYDKANGYHILWKDWHVKDLQNFVKRDRNHPSVICWSAGNEIDEQGTAR
GKEVAQELVRLFHEADPSRKVTVGCNNPNAWKNGFGEIFDIYGFNYKPHLYGEFIKQRPN
QPVIASETSSCVSTRGEYYFPVKWGIGDGFFNYQVSSYDLYAPGWAYRPDREFAAQDANP
NIAGEYVWTGFDYLGEPTPYNQDRANAGNFSNPEEAKAALERFAALGNKAPSRSSYFGIV
DLCGFPKDRFFIYQVHWRPDLKMAHILPHWNWEGREGEITPVHVYSSGDTAELFLNGKSQ
GVRVKKPGSDTEGYRFFWNDVKYEPGELKVVVTKNGQPWATATRATTGKTAAIDLQADRT
AIAGDARDISYVTVTMKDAKGNTVPTAKEPLTFTVNGPAEIIGVCNGNPVDLSGFQKNTI
DAFNGLAQVIVRGKRGESGPVTLTATSPGIKTATIKLNIAKPTAEQLKK
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgtattatagaaacccggcacccatcgtctcgcaccacattcatatgaaaaca
cactggacattacttctcactctcggtatctccgttgccaacgcagcgcccttgcccgct
acccagcgtgaaacattcgacttcggctggaaacacgcccgcttcggcaacatgcccgac
ggcaccgtacagcctgaacccggagcggaatccgcccccctcacctcttccagccacgaa
caccagaacatcgccatgaacgcgatggacggcaaccgcaacacacgctggtgcgccgcc
aacgccaaccccggccactacatcacagccgacttcggcaaacccgtagccgtcagccaa
atcaacgtcatctgggaaaaagctgcaccgcgcgactacgtcatctccggttccgataac
ggcaaaacgtggaccgacatcgccgcccgcatcggcgacaacggaacggaatcggcgcaa
aacctctacggcaaaaaccaaaaacctgccgactctcgcgcttaccgctactacaaattc
accgtcaacggaactggaggcggcaactgggccagcatccgggaaatcgaattcaccgat
gccgccggaaagaaaatcaaacccgccggcgaaaaactcaatgccaacaaagtaccgttc
ggaaccaacttcgacgacacaaaatggcgctccctcaacctcccgcacgactgggccatc
gaaggccccttccgccccgaacttgaaaacgaaaccggcaaactcccgtgggtcggcatc
ggctggtaccgcaaaagcttcgacgtacccgccgatgcaggagaacaccgctactacctc
gacttcgacggagtcctctccatgcccaaagtctacgtcaacggcgaacttgccggagaa
tggggctacggatactcctccttccgcgtagacatcagcaaacacctcaaacccggccag
aaaaacaccgtcgccgtccgtgcggaaaaccttccgcgctcatcgcgctggtacccgggc
gcaggcatctaccgccacgtatggctcaccaaaaccaaccccgtccatgtcgacaactgg
ggcgtatccatcaccaccccccaagtctccaacgacagagccacggtcgaaatcaaaaca
accgtcctcaacacatcggacaaacccgctaccgtctccgttgaaaacgccgtcgcaggc
gtagccggagctgcgggcaaaccagaaaccgtcaccatccccgccggacaaagcaaggaa
atcacctccaccatccaactcggcaaccccaaactctgggatcttgacaccccccatctc
tacgacctcgccaccaccatcaaactggacggcaaaatcatcgacaaagtcaacaacacc
ttcggcgtacgcaccgtcgaatggaaacccgatggcttctacctcaacggccgcaaagtc
cgcatcaacggcgtctgccagcatcacgacctcggaccgctcggtgccgccgtctatgcg
cgcggctacgaacgccagctcgaaatcctcaaggaaatgggggtcaactccatccgcacc
tcacacaacccgcccgctcccgaactgctggaagcgtgcgaccgcatgggcatcctcgtc
gacaacgaactcttcgacatctgggaacatcagaaatacgacaaagccaacggctaccac
atcctctggaaagactggcacgtcaaagacctccagaacttcgtcaaacgcgaccgcaac
caccccagcgtcatctgctggagcgccggcaacgaaatcgacgaacagggcaccgctcgc
ggcaaagaagtagctcaggaactcgtccgcctcttccacgaagcggatccctcccgcaaa
gtcaccgtcggctgcaacaaccccaatgcatggaaaaacggcttcggcgaaatcttcgac
atctacggcttcaactacaaaccccacctctacggcgaattcatcaaacagcgcccgaac
cagccggtcatcgcctccgaaacctcctcctgcgtctccacgcgcggcgaatactacttc
cccgtcaaatggggaatcggagacggcttcttcaactaccaggtcagctcctacgacctc
tacgcccccggctgggcctaccgccccgaccgcgaattcgccgcacaggacgccaacccc
aacatcgcgggcgaatacgtatggaccggattcgactacctcggcgaacccaccccgtac
aaccaggaccgcgccaatgcaggcaacttctccaaccctgaagaagccaaagcagccctc
gaacgcttcgccgcgctcggcaacaaagcgccctcacgcagctcctacttcggaatcgta
gacctctgcggcttcccgaaagaccgcttcttcatctaccaggtacactggcgtcctgat
ctgaaaatggcccacatcctcccccactggaactgggaaggccgtgaaggggaaatcacc
cccgtccatgtctactcctcgggcgacaccgccgaactcttcctcaacggaaaatcgcag
ggtgtacgcgtcaaaaaaccgggcagcgacaccgaaggctaccgcttcttctggaacgac
gtcaaatatgaacccggtgaactcaaagtagtcgtcaccaaaaacggccagccctgggca
accgctactcgcgccaccacaggcaaaacggcagccatcgaccttcaggccgaccgcacc
gccatcgccggagatgcacgcgacatcagctacgtcaccgtcaccatgaaagacgccaag
ggcaacaccgtacccaccgccaaagaaccgctcaccttcaccgtcaatggcccggctgaa
atcatcggcgtgtgcaacggcaacccggtcgacctctccggcttccagaaaaacaccatc
gatgccttcaacggccttgcacaagtcatcgtgcgtggcaaacgcggcgaaagcggcccc
gtcaccctcacggccacatcgcccggcatcaaaacagccaccatcaaactcaacatcgcc
aaaccgactgccgaacaactcaaaaaataa

DBGET integrated database retrieval system