KEGG   Akkermansia glycaniphila: PYTT_1977Help
Entry
PYTT_1977         CDS       T04551                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
agl  Akkermansia glycaniphila
Pathway
agl00010  Glycolysis / Gluconeogenesis
agl00030  Pentose phosphate pathway
agl00051  Fructose and mannose metabolism
agl00052  Galactose metabolism
agl00680  Methane metabolism
agl01100  Metabolic pathways
agl01110  Biosynthesis of secondary metabolites
agl01120  Microbial metabolism in diverse environments
agl01130  Biosynthesis of antibiotics
agl01200  Carbon metabolism
agl01230  Biosynthesis of amino acids
agl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:agl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PYTT_1977
   00030 Pentose phosphate pathway
    PYTT_1977
   00051 Fructose and mannose metabolism
    PYTT_1977
   00052 Galactose metabolism
    PYTT_1977
  09102 Energy metabolism
   00680 Methane metabolism
    PYTT_1977
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PYTT_1977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:agl01009]
    PYTT_1977
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:agl03019]
    PYTT_1977
Enzymes [BR:agl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PYTT_1977
Protein phosphatases and associated proteins [BR:agl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PYTT_1977
Messenger RNA biogenesis [BR:agl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PYTT_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: SEH94699
UniProt: A0A1H6M0L2
LinkDB All DBs
Position
I:complement(2331013..2331957)
Genome map
AA seq 314 aa AA seqDB search
MTSGGDAAGMNPAVKAAVERARQLGMKPFVIYDGLEGLIDGKIKAATRDLTCEMSHRGGT
LLRSSRSKRFFEYSYREQAYKHLKDNNIEHLVIAGGDGSFRALNDFFNDFQVPFAGIPAT
IDNDIAGTDYCLGVDTAQNIILNCIDTIRDTAQSHHRAFVIETMGRDCGYLAMTAAICSG
ADILVVPELPYDLESIKKRLQPQIEEGVGYVIAIVAEGTKKAQELTDWLSTNTGMDTRLT
VLGHMQRGGAPSARDRLMGARFGTRAVEALHSGNINRIMVYHDGHHGECALDQVAGQKYH
VSQSIIKLCEDMTR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacctctggtggagatgctgccgggatgaaccctgcagtaaaggcggccgtggaacgc
gcccgccaacttggaatgaagccgttcgtcatctacgacggcctggaaggtctgatcgac
ggcaaaatcaaagccgctacccgtgatctcacctgcgaaatgtcgcaccgcggcggcacc
ctgctccgctcctcgcgctccaaacgcttcttcgagtacagctaccgcgaacaggcgtac
aagcacctcaaggacaacaacatcgaacacctcgtcattgcaggcggcgacggctccttc
cgcgcgctcaacgacttcttcaacgacttccaggtaccctttgcaggcatccccgccacc
atcgacaacgacatcgcgggcacggactactgcctcggcgtcgacaccgcgcagaacatc
atcctcaactgcatcgacaccatccgcgacaccgcccagtcccatcaccgcgccttcgtc
atcgaaaccatggggcgcgactgcggctacctcgccatgaccgccgccatctgcagcggg
gcggacatcctcgtcgtccctgaactcccctacgacctcgaatcgatcaaaaagcgtctc
cagccgcaaatcgaggaaggcgtcggctacgtcatcgccatcgtcgcggaaggcaccaaa
aaggctcaggaactcactgactggctcagcaccaacaccggcatggacacccgcctcacc
gtcctcggccatatgcagcgcggtggagcgccctcggcacgagaccgcctcatgggagca
cgcttcggcacacgcgccgtagaagcccttcattccggcaacatcaaccgcatcatggtc
tatcatgacggacaccacggcgaatgcgccctcgatcaggtggccgggcagaaataccat
gtcagccaaagcatcatcaaactttgcgaagacatgactcgctaa

DBGET integrated database retrieval system