KEGG   Akkermansia glycaniphila: PYTT_2492Help
Entry
PYTT_2492         CDS       T04551                                 

Definition
(GenBank) proc: pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
agl  Akkermansia glycaniphila
Pathway
agl00330  Arginine and proline metabolism
agl01100  Metabolic pathways
agl01110  Biosynthesis of secondary metabolites
agl01130  Biosynthesis of antibiotics
agl01230  Biosynthesis of amino acids
Module
agl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:agl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PYTT_2492
Enzymes [BR:agl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PYTT_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH OCD_Mu_crystall TrkA_N ApbA 2-Hacid_dh_C Sacchrp_dh_NADP TPR_4
Motif
Other DBs
NCBI-ProteinID: SEI00561
UniProt: A0A1H6MRJ6
LinkDB All DBs
Position
I:2953994..2954824
Genome map
AA seq 276 aa AA seqDB search
MCYDHAMMKLGVIGCGQMGRALLGGILRACVVREADVYLFNRTPEACSQIVREFPSVHVC
GSIREMAALADMVILSVKPAGVCSALAELASAEGKKPCVLSIAAGVTLATMQSCAPELRM
VRAMPNTPALVGMGASSFCGGSLATQDDLAAARRLLEAVGIAVELPEEKIHAVIGVAGSA
PAYMFTILDAMADAGVSLGLTRGDALKLATQTMLGSARLVQESGRHPMELRDAVTSPGGT
TIAALNAMDAHNLRYAVIAGVREAARKSEEMSRGQS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtgctatgatcatgccatgatgaaattgggtgtgatcggttgcggccagatgggccgt
gctttgctgggggggatcctcagggcgtgtgtggtgcgcgaagcggatgtgtacctgttc
aacaggacgcccgaagcgtgcagtcaaatcgtgcgggagtttccctctgtgcatgtgtgc
ggctccatccgtgagatggcagctctggctgatatggtgattctgtccgtaaagcccgca
ggagtgtgctctgctttggcggagttggcatctgccgaagggaagaagccctgcgtgctg
tcgatcgccgccggggtgactctggcgacgatgcaatcctgtgcgccggagttgcgcatg
gtgagagcgatgccgaatacgcccgcgctggtgggcatgggtgcttcttcgttctgcggt
ggcagcctggcgacgcaggatgatttggcggcagcccgccgcttgctggaagccgtcggc
attgccgtcgagctgccggaggagaagattcacgcggtgatcggagttgccgggtcggct
cccgcctatatgttcacgattctggatgcgatggcggatgccggagtatcgctcggtttg
acgcgtggagatgccctgaagctggcgacgcagacgatgctgggttccgcccggctggtg
caggagtccggcaggcatccgatggaattgcgcgatgcggtgacttcgcccggagggacg
acgattgctgcgctgaatgcaatggatgcacacaatttgcgctatgccgtgattgccggg
gtgcgcgaagctgcccgcaagagcgaggagatgtcgcgcggtcaaagctga

DBGET integrated database retrieval system