KEGG   Agromyces sp. MF30-A: DCE93_00255Help
Entry
DCE93_00255       CDS       T05411                                 

Definition
(GenBank) 2-deoxy-scyllo-inosamine dehydrogenase
  KO
K17818  D-arabinitol dehydrogenase (NADP+) [EC:1.1.1.287]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00040  Pentose and glucuronate interconversions
agm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DCE93_00255
Enzymes [BR:agm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.287  D-arabinitol dehydrogenase (NADP+)
     DCE93_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP Shikimate_DH TrkA_N FAD_binding_3 NAD_binding_7 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AWB94298
UniProt: A0A2S0WSN0
LinkDB All DBs
Position
50195..51208
Genome map
AA seq 337 aa AA seqDB search
MKAVVYSAPTEFEVTDIPDPVPGPGEIRFRVELAGVCGTDLHVHDGTFFAEFPLTPGHEP
VGIVDAIGEGVEGFEIGQRIVATGVGGCGECENCRRGKRLLCTSLTALGVTGPGGFAEYM
IAPARWCFDASDLDPEQAVLAEPTACAIHGVERLAPRPGSSALVIGAGPTGLILAQLLAH
GNAATVTVAAPSAHKLELAARFGADEVVRIGRDGSGYDELRRIAPNGFDIVVDATGAASV
TQRALGHVRDGGTLLVYGVTDPSDTVEFSPFDVYRREITITGSFAQIDSFPAALAALRSG
RVATEGLISHVFAIEDFEQALSTLRSDPTAHKVVIRP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtggtctacagcgccccgaccgagttcgaggtgaccgacatccccgacccc
gttcccggacccggggagatccgcttccgcgtggagctggccggagtctgcggcaccgac
ctgcacgtgcacgacggcaccttcttcgccgagttcccgctcaccccggggcacgagccc
gtcggtatcgtcgatgcgatcggcgaaggggtcgagggcttcgagatcggccagcgcatc
gtcgcgaccggcgtcggcggctgcggtgagtgcgagaactgccggcgcggcaaacgcctg
ctgtgcacctcgctcaccgcgctcggcgtcaccgggccgggcggattcgccgagtacatg
atcgccccggcgcgctggtgcttcgatgcctccgacctcgaccccgaacaggccgtgctc
gccgaaccgacggcgtgcgcgatccacggcgtcgaacggctcgcgccgcggcccggttcg
agcgccctcgtgatcggcgccggcccgaccgggctgatcctcgcccagctcctcgcgcac
ggcaacgcggcgaccgtcaccgtggccgcgccgtcggcgcacaagctcgagctcgcggcc
aggttcggcgccgacgaggtcgtgcgcatcggccgcgacggctcgggctacgacgagctg
cgcaggatcgccccgaacggcttcgacatcgtcgtcgacgcgaccggtgcggcatccgtc
acccagcgtgcgctcggccacgtgcgcgacgggggcacgctgctcgtctacggcgtcacc
gacccctcggacacggttgagttcagcccgttcgacgtgtaccgccgtgagatcacgatc
accgggtcgttcgcccagatcgactccttcccggcggcgctcgcggcgctgcgctcgggc
cgggtggcgaccgaaggcctgatcagccacgtcttcgccatcgaggacttcgagcaggcg
ctctcgacgctgcgctccgacccgacggcgcacaaggtggtgatccgtccgtga

DBGET integrated database retrieval system