KEGG   Agromyces sp. 30A: DCE93_01325Help
Entry
DCE93_01325       CDS       T05411                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
agm  Agromyces sp. 30A
Pathway
agm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:agm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DCE93_01325
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:agm03400]
    DCE93_01325
Enzymes [BR:agm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DCE93_01325
DNA repair and recombination proteins [BR:agm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DCE93_01325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AWB94479
UniProt: A0A2S0WT17
LinkDB All DBs
Position
282732..285197
Genome map
AA seq 821 aa AA seqDB search
MAEGARQLVEVDGRRLRLTNLDKVMYPETGMTKGEVISYYAEIAPVMVPLVAGRPVTRKR
WVHGVGTADAPETAFFEKNLAEHAPEWVRRGIQHHSDGDKAYPIAGDRATLVWLAQQAAL
ELHVPQWRFDARGEPAGPDRMVFDLDPGEGMGLAECAEVARHVRALLEGMGLEAIPVTSG
SKGIHLYAALDGSQTSDQVSAVAHELARALEADHPELIVSSMRKTLRTGRVLIDWSQNNG
KKTTIAPYSLRGRSRPTVAAPRTWHELEAPDLRQLEASDVLARVAESGDPMGTFTEHSHA
GPLSAYLSMRTSGATPEPMPASAWGQVSGGPPSGSGPRFVIQEHHARRLHYDLRLERDGV
MKSWAVPKGVPETSGTNHLAVQTEDHPMEYATFEGTIPRGEYGAGSMTIWDTGVYAAEKW
RDDEIIIDLDGQAGGPLGGPARLALIRTDGQGEKSSWLLHRMKDQAPGAARAAAAASADG
GAGDLDARPPATGAPRPAGRVGPISQRPMLATAASLGMLTGEEWALEWKWDGIRVLARVE
AGGMRLLSRNGVDITARYPDLASLPSVVRGDAVVDGEIVALDTDGRPDFGRLQRRMNLTK
PREIERVAASVPVRLLLFDVLEVDGRPVTDEPYRQRRARLAGLMRMKRGVPVEVPAPATG
TPEEALAESRRLGLEGIVAKRPDSPYRPGARSSDWLKHKLTLTQEVVIGGYRRGAGTRTG
RIRSLLVGIPGDRGLEYAGRVGSGLGELALERLLAALRPLEQAESPFVEVPAADMSDAVW
VRPELVGEIELSDWTSTGVARHPRWRGLRPDKAPAEVERET
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggctgagggcgcgcggcagctcgtcgaggtcgatggccgacgcctgcggctgacgaac
ctcgacaaggtcatgtatcccgagacgggcatgacgaagggcgaggtgatctcgtactac
gccgagatcgcccccgtcatggtgcctctcgtcgccgggcgtccggtcacgcgcaaacgc
tgggtgcacggcgtcggcacggcggatgccccggagacggcgttcttcgagaagaacctc
gccgagcatgcacccgagtgggtgcgccgaggcatccagcaccactccgacggcgacaag
gcgtacccgatcgccggcgatcgggcgacgctcgtgtggctggcccagcaggccgccctc
gagttgcacgtaccgcaatggcggttcgacgcccgcggggagccggcgggccccgaccgg
atggtcttcgacctcgaccccggtgagggcatgggcctcgccgagtgcgcagaggtcgct
cgccacgtgcgcgccctcctcgagggaatgggcctcgaggcgatccccgtgacgagcggc
agcaagggcatccacctctacgcggcgctcgacggctcgcagacctccgaccaggtgtcg
gcggtcgcgcacgaactcgcgagggcgctcgaggccgaccaccccgagctcatcgtctcg
agcatgcgcaagacgctgcgcacggggcgcgtgctcatcgactggagtcagaacaacggc
aagaagacgacgatcgcgccgtactccctccgcgggcggtcgcgcccgacggtcgcggcg
ccgcgcacctggcacgagctcgaggcccccgatctccgtcagctcgaggcatccgacgtg
ctcgcccgcgtcgcggagtcgggcgacccgatggggacgttcaccgagcactcgcacgcc
ggcccactctcggcgtacctctcgatgcgcacgagcggcgccactcccgaacccatgccc
gcctcggcgtggggacaggtcagtggcggaccgccgagcggcagcgggccgcgtttcgtg
attcaggagcatcacgcgcggcgcctgcactacgacctgcgactcgagcgagacggcgtc
atgaagagctgggccgtgccgaagggagtgcccgagacctccggcacgaaccacctcgcc
gtgcagaccgaagaccacccgatggagtatgcgacgttcgagggcacgatcccgaggggg
gagtacggcgcgggctcgatgacgatctgggacacgggcgtctacgccgccgagaagtgg
cgcgacgacgagatcatcatcgacctcgacgggcaggcgggcggcccgctgggtggaccg
gcgcgactcgcactcatccgcaccgacgggcagggcgagaagagctcgtggctgctgcat
cggatgaaggatcaggctccgggcgcggctcgagcggcggcggcggcatcggcggatggc
ggcgccggcgacctcgatgcgcgccctcctgcgacgggcgctcctcgaccagcggggagg
gtcggcccgatctcgcagcgtccgatgctcgcgaccgccgcctcactcggcatgctcacg
ggcgaggagtgggcgctcgagtggaagtgggacggcatccgggtgctcgcccgcgtcgaa
gcgggcggcatgcggctgctcagccgcaacggagtcgacatcaccgcccgctaccccgac
ctcgcctcccttccgtccgtcgtgcgcggtgatgcggtcgtcgacggcgagatcgtcgcg
ctcgacaccgatggccgccccgacttcggtcgcctgcagcgccggatgaacctcaccaag
ccgcgcgagatcgaacgggtcgcggcatccgtgcccgtgcgcctgctgctgttcgacgtg
ctcgaggtcgacggccggccggtcaccgacgagccctaccgccagcgccgggcccgactc
gcaggcctcatgcggatgaagcgcggtgtgccggtcgaggtgccggcgccggcgaccggc
acccccgaggaggcgctcgcggagagtcgacggctcggcctcgagggcatcgtcgcgaag
cggcccgactccccgtatcggcccggcgcccgcagctccgactggctcaagcacaagctc
acgctcacgcaggaggtcgtgatcggcggctatcggcgcggcgctggcacgcgcaccggc
cgcatccgctcgctgctcgtcggcatccccggagatcgcgggctcgagtacgccgggcgc
gtcggctcgggactcggcgagctcgccctcgagcggctgctcgcggccctgcggccgctc
gaacaggccgaatccccattcgtcgaggtgcccgcagccgacatgagcgacgccgtctgg
gttcgccccgagctcgtcggcgagatcgagctcagcgactggacgagcaccggcgtcgcg
cggcatccgcgctggcggggcctgcggcccgacaaggcgccggccgaggtcgagcgcgag
acctga

DBGET integrated database retrieval system