KEGG   Agromyces sp. MF30-A: DCE93_01885Help
Entry
DCE93_01885       CDS       T05411                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00250  Alanine, aspartate and glutamate metabolism
agm00280  Valine, leucine and isoleucine degradation
agm00310  Lysine degradation
agm00410  beta-Alanine metabolism
agm00640  Propanoate metabolism
agm00650  Butanoate metabolism
agm01100  Metabolic pathways
agm01120  Microbial metabolism in diverse environments
Module
agm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DCE93_01885 (gabT)
   00650 Butanoate metabolism
    DCE93_01885 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DCE93_01885 (gabT)
   00280 Valine, leucine and isoleucine degradation
    DCE93_01885 (gabT)
   00310 Lysine degradation
    DCE93_01885 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DCE93_01885 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:agm01007]
    DCE93_01885 (gabT)
Enzymes [BR:agm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DCE93_01885 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     DCE93_01885 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     DCE93_01885 (gabT)
Amino acid related enzymes [BR:agm01007]
 Aminotransferase (transaminase)
  Class III
   DCE93_01885 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AWB94573
UniProt: A0A2S0WTA1
LinkDB All DBs
Position
402168..403526
Genome map
AA seq 452 aa AA seqDB search
MTLVDTPAITTGGPSLAQERRLVTAIPGPRSQELMARKAAAVASGVGTTIPVSVVAAGGG
VIVDADGNSLIDLGSGIAVTGVGNANPRVVEAVTAQLNAFTHTCFTVAPYDNYVAVAEKL
NALTPGDHVKRSALFNSGAEAVENAVKIARHYTKKQAVVAFDHAYHGRTNLTMGLTARNI
PYKSGFGPFASEVYRAPLSYPFRDGGLSGAEAAARAISVIEKQVGAENLAAIIIEPIQGE
GGFIVPAQGFLPALVEWARANDVVFIADEVQTGFARTGAWFASEHEGIVPDLVVTAKGIA
GGLPLSAVTGRAEIMDSAMAGGLGGTYGGNPLACAAALATIESYEEDGLIGRAREIGAVL
IGRLNALRTADPRIGDVRGRGAMVAIELVDPETGAPDAALTKAVAEHAHANGVVVLTCGT
YGNVIRFLPPLTISDELLVDGLGVVAEGLKTA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgtcgacaccccggccatcacgaccgggggaccttcgctcgcacaggagcgc
cgtctcgtcaccgccatcccaggcccgcgctcgcaggagctcatggcccgcaaggccgcg
gccgtcgcctcgggcgtcggcacgaccatccccgtctcggtggtcgcagcaggcggcggc
gtcatcgtcgacgccgacggcaactcgctcatcgacctcggctcgggcatcgcggtcacc
ggtgtcggcaacgcgaacccccgcgtcgtcgaggccgtcaccgcgcagctgaacgccttc
acgcacacgtgcttcacggtcgccccgtacgacaactacgtcgcggtcgccgagaagctc
aacgccctcacgcccggcgatcacgtcaagcgctcggccctcttcaactcgggcgccgag
gccgtcgagaacgcggtcaagatcgcccgccactacaccaagaagcaggccgtcgtcgcg
ttcgaccacgcctaccacggacgcacgaacctcacgatggggctcaccgcgaggaacatc
ccgtacaagagcgggttcggaccattcgcctcagaggtgtaccgcgcgccgctcagctat
cccttccgcgacggcggcctctcgggcgccgaggcagcggcccgcgccatctcggtcatc
gagaagcaggtcggcgccgagaacctcgccgcgatcatcatcgagccgatccagggtgag
ggcgggttcatcgttccggcgcagggcttcctccccgcgctcgtcgagtgggcccgcgcg
aacgacgtcgtgttcatcgccgacgaggtgcagaccggcttcgcccgcaccggcgcctgg
ttcgcgagcgagcacgagggcatcgtgcccgacctcgtggtcacggcgaagggcatcgcc
ggtggcctgccgctctcggcggtcacggggcgcgccgagatcatggactccgcgatggcc
ggcggcctcggcggcacctacggcggcaacccgctcgcctgcgccgcggcgctcgccacg
atcgagtcgtacgaggaagacggcctcatcgggcgcgctcgcgagatcggcgccgtgctg
atcggccggctcaacgccctgcgcacggccgaccccaggatcggcgacgtgcgcggccgc
ggcgcgatggtcgcgatcgagctcgtcgaccccgagaccggcgcgcccgacgcggcgctc
acgaaggccgtcgccgagcacgcccacgcgaacggcgtcgtcgtgctcacctgcggcacc
tacggcaacgtcatccgcttcctgccgccgctcacgatctccgacgaactgctcgtcgac
ggcctcggcgtcgtcgcggaaggactgaagaccgcatga

DBGET integrated database retrieval system