KEGG   Agromyces sp. 30A: DCE93_05255Help
Entry
DCE93_05255       CDS       T05411                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
agm  Agromyces sp. 30A
Pathway
agm00010  Glycolysis / Gluconeogenesis
agm00030  Pentose phosphate pathway
agm00051  Fructose and mannose metabolism
agm00052  Galactose metabolism
agm00680  Methane metabolism
agm01100  Metabolic pathways
agm01110  Biosynthesis of secondary metabolites
agm01120  Microbial metabolism in diverse environments
agm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:agm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCE93_05255
   00030 Pentose phosphate pathway
    DCE93_05255
   00051 Fructose and mannose metabolism
    DCE93_05255
   00052 Galactose metabolism
    DCE93_05255
  Energy metabolism
   00680 Methane metabolism
    DCE93_05255
Enzymes [BR:agm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DCE93_05255
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     DCE93_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AWB95138
LinkDB All DBs
Position
1108081..1109112
Genome map
AA seq 343 aa AA seqDB search
MKIGILTSGGDCPGLNSVIRGAVLKGVISHEAEFVGFRWGWKGVVEADIMPITRHDVRGL
AKQGGTILGSSRTNPFEGEGGGPENIQRMLDEHGIDAIIAIGGEGTLTAARRLHDEGGIN
VVGVPKTIDNDLAATDYSFGFDTAVEIATEAIDRLRTTADSHGRCMVLEVMGRHVGWIAL
HSGMAGGAHAILIPEQPQSIEQICEWVESVRDRGRAPLVVVAEGFTLPGMNEAHSHKGLD
AFNRPRLGGISEQLAPMIEERTGIESRATVLGHIQRGGAPSAYDRVLATRLGMAAVDAVY
DQAWGSMVTLRGTDIRTVSIADAVGTLNRVPQSRYDEARILFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcattcttacgtcgggcggcgactgccccggcctcaactccgtcatccgc
ggtgcggtgctgaagggcgtcatctcgcacgaggccgagttcgtcgggttccgctggggc
tggaagggcgtcgtcgaggccgacatcatgccgatcacccggcatgacgtgcgcggtctc
gccaagcagggcggcacgatcctcggatcgagccgcaccaacccgttcgagggcgagggc
gggggccccgagaacatccagcgcatgctcgacgagcacggcatcgacgcgatcatcgcg
atcggcggcgagggcaccctgacggcggcgcgccgcctgcacgacgagggcggcatcaac
gtcgtcggcgtgccgaagaccatcgacaacgacctcgcagcgaccgactactcgttcgga
ttcgacaccgcggtcgagatcgccaccgaggcgatcgaccgcctgcgcaccaccgccgac
tcccacggccgctgcatggtgctcgaggtcatgggccgccacgtcggctggatcgccctg
cactccggcatggccggcggcgcccacgcgatcctcatccccgagcagccgcagtcgatc
gagcagatctgcgagtgggtcgaatcggtgcgcgatcgcggccgggcgccgctcgtcgtc
gtcgccgaggggttcacgctgccgggcatgaacgaggcgcactcgcacaagggcctcgat
gcgttcaaccggcccaggctcggcggcatctccgagcagctcgccccgatgatcgaggag
cgcacgggcatcgagtcgcgggcgaccgtgctcggccacatccagcgcggcggcgccccg
tcggcatacgatcgcgtgctcgccacccgactcggcatggccgccgtcgacgccgtctac
gaccaggcgtgggggtcgatggtgacccttcgcggcaccgacatccgcaccgtctcgatc
gccgacgcggtcggcaccctcaaccgggtgccgcagtcgcgctacgacgaggcgaggatc
ctcttcggctga

DBGET integrated database retrieval system