KEGG   Agromyces sp. MF30-A: DCE93_08735Help
Entry
DCE93_08735       CDS       T05411                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00970  Aminoacyl-tRNA biosynthesis
agm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DCE93_08735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:agm03029]
    DCE93_08735
Enzymes [BR:agm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DCE93_08735
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DCE93_08735
Mitochondrial biogenesis [BR:agm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DCE93_08735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln C9orf72-like
Motif
Other DBs
NCBI-ProteinID: AWB95737
UniProt: A0A2S0WWK6
LinkDB All DBs
Position
complement(1832964..1833266)
Genome map
AA seq 100 aa AA seqDB search
MSEITAEQVAHLANLARIALTDEEIEHLTTELGQIMHAVEKVSEVATPEVPPTSHPIPMQ
NVYRDDVVGETVLSVDEALSGAPESDDSRFKVSAILGEEQ
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaatcactgcggagcaggtcgcgcatctcgcgaacctcgcccgcatcgcgctc
accgatgaagagatcgagcacctcacgacggagctcggccagatcatgcacgcggtcgag
aaggtgagcgaggtggccacgcccgaggtgccgccgacgagccacccgatcccgatgcag
aacgtgtaccgcgacgatgtcgtgggtgagacggtgctctcggtcgacgaggcgctctcg
ggcgcccccgagagcgacgactcccggttcaaggtctcggcgatcctgggagaagagcag
tga

DBGET integrated database retrieval system