KEGG   Anoxybacillus gonensis: AFK25_01095Help
Entry
AFK25_01095       CDS       T04000                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00473  D-Alanine metabolism
agn01100  Metabolic pathways
agn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFK25_01095
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AFK25_01095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:agn01011]
    AFK25_01095
Enzymes [BR:agn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AFK25_01095
Peptidoglycan biosynthesis and degradation proteins [BR:agn01011]
 Precursor biosynthesis
  Racemase
   AFK25_01095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Ndufs5
Motif
Other DBs
NCBI-ProteinID: AKS37198
UniProt: M5R6F8
LinkDB All DBs
Position
194013..195170
Genome map
AA seq 385 aa AA seqDB search
MDQAFYRDTWAEIDLDAIFYNVQSMKQHVGPHVEVIAVVKANAYGHGDIQVAKTALEAGA
TRLAVAFLDEALALRKKGVSLDVPILVLGATNPQYASLAASQNIALTVFRADWFEQAFMY
GPYEQPLNVHIKLDTGMGRLGVKTKEEVQRIVNIVEQKESFVIEGVYTHFATADEQNVDY
FSFQYDTFMHMLEWLPAKPPLIHCANSAAGLRYPDRVFNAVRLGISMYGLAPSQEMKPLL
PYPLKEAFSLHSRLTHVKKVKAGEKISYGATYEAKVDEWIGTVPIGYADGWLRRMQHFSV
LVDGKRAPIVGRVCMDQMMIRLPYELPVGTKVTLIGEQKGERISVDDVATHLNTINYEIP
CTISYRVPRIFLKNKSIIEVRNAVL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagcattttatcgcgatacatgggcagaaattgatttagatgccattttttat
aatgtgcaatcgatgaagcagcatgtcggtccgcatgtcgaagtcattgctgtggtgaag
gcgaacgcttatggacatggggatatccaagtagcgaaaaccgcgctagaagcaggtgca
acgagattagcagtcgcttttttagatgaagcgctagcgctgagaaaaaaaggggtttct
ttagacgtaccgattctcgtacttggagcgacaaaccctcaatatgcgtcgttagccgcc
agtcaaaacattgcgttaactgtttttcgagccgactggtttgaacaagcattcatgtat
ggaccgtatgagcaaccgttgaacgttcatataaaattggatacagggatggggcgacta
ggagttaaaacgaaagaagaagtgcaacgaattgtaaacatagtggaacaaaaagaatcg
tttgttattgaaggagtatatacgcattttgcaacagccgatgaacaaaatgttgactat
ttttcgtttcaatacgatacatttatgcacatgctagagtggcttcctgcaaaacctccg
ctcattcattgcgccaatagcgccgcgggactgcgttatcctgatcgagtatttaatgcc
gtacgcttaggcatctcgatgtatgggttggcaccgtcgcaagaaatgaaaccattgtta
ccttatccgttaaaagaagcgttctcgctccatagtcgtttaacgcatgtaaaaaaggtg
aaagctggagaaaaaataagctatggagcgacatatgaggcaaaagtagatgagtggatt
ggtacggttccaatcggttacgcagacggttggttacgtcgtatgcaacatttttctgtt
cttgttgatggaaagcgcgcccctattgttggacgtgtttgtatggaccaaatgatgatt
cgtctgccgtatgagcttcctgtcggtacaaaagtgacgctcatcggtgaacaaaaaggt
gaacgcatttctgttgatgatgttgcaacccatttgaacacaattaattatgaaattcct
tgtacaattagttatcgtgttccccgtatttttttaaaaaacaagagtataattgaagtg
agaaatgcggtattatag

DBGET integrated database retrieval system