KEGG   Anoxybacillus gonensis: AFK25_01850Help
Entry
AFK25_01850       CDS       T04000                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00010  Glycolysis / Gluconeogenesis
agn00071  Fatty acid degradation
agn00350  Tyrosine metabolism
agn00625  Chloroalkane and chloroalkene degradation
agn00626  Naphthalene degradation
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01120  Microbial metabolism in diverse environments
agn01130  Biosynthesis of antibiotics
agn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:agn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFK25_01850
  Lipid metabolism
   00071 Fatty acid degradation
    AFK25_01850
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFK25_01850
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AFK25_01850
   00626 Naphthalene degradation
    AFK25_01850
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFK25_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_11 Glyoxalase_5 TrkA_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKS37328
UniProt: A0A0A2SQL8
LinkDB All DBs
Position
complement(342594..343607)
Genome map
AA seq 337 aa AA seqDB search
MKAAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGVIEEVGPGVTHLKVGDRVGIPWLYSACGHCDYCLSGQETLCEHQQNAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGAKPGEWVAIYGIGGLGHVA
VQYAKAMGLNVVAVDLGDEKLELAKQLGADLVVNPKHEDAAQWMKEKVGGVHAAVVTAVS
KAAFESAYKAIRRGGACVLVGLPPEEMPVPIFDTVLNGVRIIGSIVGTRKDLQEALQFAA
EGKVKTIVEVQPLENINDVFDRMLKGQINGRVVLKVD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagttgtggaacaatttaaagaaccattaaaaattaaagaagtagaaaaa
ccaacaatttcatatggagaggtgctagtgcgcattaaagcgtgtggagtatgtcataca
gacttgcatgccgcacatggcgactggcctgtaaagccaaaactaccgctcattcctgga
catgaaggcgttggtgtcatcgaagaagtcggaccaggggtgacgcacttaaaagtcgga
gatcgcgtcggtatcccttggctttattccgcctgcggccattgtgattattgcttaagc
ggacaagaaacattatgtgagcatcaacaaaacgctggatattcggttgacggtggttac
gctgaatattgtcgtgctgcagctgattatgtcgtgaaaattcctgataacttatcattt
gaagaagctgctccaatcttttgcgctggcgtaacaacatataaagctttaaaagtaaca
ggtgcaaaacctggtgagtgggtagcaatttacggtattggcggcctcggacacgtcgct
gttcaatatgcaaaggcgatggggctaaacgtcgttgctgtcgatttaggcgatgaaaaa
cttgagttagctaaacagttgggagctgatcttgtcgtcaatccaaaacatgaagacgcc
gcgcaatggatgaaagaaaaagttggtggcgtgcatgcagctgtcgtcactgctgtttcg
aaagcagcattcgaatcagcctataaagcaattcgtcgcggcggcgcttgcgtacttgtc
ggattaccgccagaagaaatgcctgtaccaatttttgataccgttttaaatggagtaaga
attatcggttcaatcgttggtacgcgtaaagacttgcaagaagcgcttcaatttgcggca
gaaggaaaagtaaaaacaattgtcgaagttcaaccgcttgaaaacattaacgatgtattc
gatcgtatgttaaaaggacaaattaacggtcgcgttgtgttaaaagtagattaa

DBGET integrated database retrieval system