KEGG   Anoxybacillus gonensis: AFK25_02120Help
Entry
AFK25_02120       CDS       T04000                                 

Definition
(GenBank) hypothetical protein
Organism
agn  Anoxybacillus gonensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKS37361
UniProt: A0A0A2SII2
LinkDB All DBs
Position
complement(385707..386177)
Genome map
AA seq 156 aa AA seqDB search
MYTEEKFLDFLIKAKKATYASQGDNASVTPLLEGSRQLEFQEGHFLYRDVYFGMSYFAGQ
EVVYYQGNPIWSMCYSGGVDKEFEIEFVKEVYSFLRKAMRNVSADNPFRGPKEFVEGDYI
YRDSNKGELGKFVGKETISFANEVVYSLHYSGGFIK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtacacagaagagaaatttttggactttttaattaaagcaaaaaaagcaacttatgca
tcacaaggagacaatgcgtctgtaacgcctttgttagaaggttcacgtcaattggagttc
caagaaggtcattttttatatcgtgatgtatattttgggatgagttattttgcaggccaa
gaagttgtctactatcaggggaatccgatttggtctatgtgttattcaggcggtgtggat
aaagaatttgagattgaatttgtaaaagaagtttactcttttttaagaaaagcgatgaga
aatgttagtgcggataatccgtttcgtggacctaaagaatttgttgagggagattatatt
tatagagatagcaataagggagaattaggtaagttcgtaggaaaagagacgatatccttt
gccaacgaagttgtatatagtcttcactactctggtggatttattaaataa

DBGET integrated database retrieval system