KEGG   Anoxybacillus gonensis: AFK25_03200Help
Entry
AFK25_03200       CDS       T04000                                 

Definition
(GenBank) alpha-amlyase
Organism
agn  Anoxybacillus gonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase GHL10 GHL6 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: AKS37565
UniProt: A0A0A2T270
LinkDB All DBs
Position
574939..576453
Genome map
AA seq 504 aa AA seqDB search
MKRVFRALLIFVLLLSVTTPASAKTERAWQDERIYFIMVDRFNNGNPKNDYDVNVHDPKA
YHGGDLQGIIDKLDYIKEMGFTAIWLTPIFANEKGGYHGYWIEDFYKVEEHFGTLDDFKR
LVKEAHKRDMKVILDFVVNHTGYNHPWLNDPAKKDWFHEKKDIFNWANQQEVENGWLFGL
PDLAQENPEVKAYLFDVAKWWIKETDVDGYRLDTVKHVPKSFWDEFSKEVKSVKQDFFLL
GEVWHDDPRYVAEYGKHGIDALIDFPFYKEASTIFSNVDQSLEPLYNVWKRNVAFYDRPY
LLGTFLDNHDTVRFTRLALQNRINPVTRLKLGLTYLFAAPGIPIMYYGTEIALDGGEDPD
NRRLMNFRTDKELIDYVTKLGELRETLPSLRRGDFELLYEKDGMALFKRTYGKETTVIAI
NNTSKTQKVTLDDELEQGKELRGLLAGDLVRSKDGKYDIILDRETAEIYVLAPKTGLNIP
FIAALLAVYTAFGLFLYFARKRKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtatttcgtgcgctacttatttttgttttgttgttgtccgtgacgacgcca
gcgagtgcgaaaacggagcgagcgtggcaagatgagcgcatttattttattatggtcgac
cgttttaataacgggaatccgaaaaacgattacgatgtaaatgtgcatgatccgaaagca
taccatggcggtgatttgcaagggattattgacaagctcgattacataaaggaaatgggc
tttacagccatttggctgacgccgatttttgcgaacgaaaagggcgggtatcacggctat
tggattgaagacttttataaagtagaagagcattttggaacgcttgatgacttcaaacgg
cttgtgaaagaagcgcataaacgcgatatgaaagtcattttagatttcgttgtcaatcat
acgggctacaatcatccgtggctaaatgatccagcgaaaaaagattggtttcatgagaaa
aaagacatttttaattgggcgaaccaacaagaagtagaaaacggttggttgtttggcctc
ccggatttagcgcaagaaaatccggaagtgaaagcgtatttattcgatgtcgcgaaatgg
tggataaaagaaacagacgttgacggatatcgtttagatacggtaaaacatgtgccaaaa
tcgttttgggacgagttttcaaaagaagtgaagtcggtgaaacaagactttttccttctt
ggagaagtatggcatgacgacccacgttatgtcgcggaatatgggaagcacggcatcgat
gcgctaattgattttccgttttacaaagaagcgtcaaccattttttcaaacgtcgatcaa
tcgcttgagccgctttacaacgtatggaagcgaaacgtggcgttttatgaccgaccgtat
ttgctcggaacgtttttagacaatcacgataccgttcggtttactcgtttagcgttgcaa
aatcgcatcaatccggtgacgcgtttaaagctcggattgacgtatttgtttgcagcgccg
ggcattccaatcatgtactatggaacagaaattgcgcttgacggcggggaagatccagat
aaccgtcgtttaatgaatttccgtaccgataaagagttgattgattatgtgacaaagctt
ggggaattgcgcgagacacttccgtcgcttcgtcgcggtgattttgaattgctttatgaa
aaagatggcatggctctatttaagcggacgtatggaaaggaaacgacggtaattgcgatc
aataatacgtcaaaaacgcaaaaagtgacgctcgacgatgagctagaacaaggaaaagaa
ttgcgcgggttgctggcgggagatttagtgcgcagcaaagacggcaagtacgacatcatt
ttagatcgcgaaacggcggaaatttacgtgcttgcgccaaaaacgggattaaacattccg
tttattgcggcgcttcttgcggtatatacggcatttggtctgtttttatacttcgcgcgc
aaacgaaaagcataa

DBGET integrated database retrieval system