KEGG   Anoxybacillus gonensis: AFK25_05530Help
Entry
AFK25_05530       CDS       T04000                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
agn  Anoxybacillus gonensis
Brite
KEGG Orthology (KO) [BR:agn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:agn03036]
    AFK25_05530
Chromosome and associated proteins [BR:agn03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    AFK25_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_21 AAA_15 AAA_29 SbcCD_C
Motif
Other DBs
NCBI-ProteinID: AKS38017
UniProt: A0A0A2T0L9
LinkDB All DBs
Position
1033527..1037087
Genome map
AA seq 1186 aa AA seqDB search
MFLKRLEAIGFKSFADRISIDFVPGMTAIVGPNGSGKSNITDAIRWVLGEQSAKSLRGAK
MEDVIFSGSESRKPLNVAEVTLTLDNSDQFLPLEYEEVSVTRRVYRSGDSEFFINKQPCR
LKDIVDLFMDSGVGREAFSIISQGKVEEILSSKPEDRRMIFEDAAGVLKYKMRKKKAEHK
LSETEDHLQRVQDILHELNQQLEPLKQQASIAKEYIEKKEQLQTYEVGLIVYEIEQLHEK
WEALKEQLAIHEQNEIELATTLQKEEAHIAELRHELTALDESIDGLQQVLLLVSEELEKM
EGKKQVLKERKNNAHKQQHQMEQTVAQLAERERVLEATIAEKKKLLQQLQTNVQALQAEL
KEKNNVLSAYGPKAEAEIERLKSEYIDLVHEQATLKNERTHTEAQLQKNEEKQRQLIAAN
DEHIRAYEQIVQQWEQKQQLVHQLQQRIAEQEEAVKTKEQQLAVQKEQYRKKEATLYEAY
QYVQKMKSKKEMLEAMQQEYAGFFQGVKEVLKAKDRLPGIHGAVVELMTVPSELETAIEV
ALGGAAQHIVVENEQSAREAIQFLKRHAYGRATFLPLNVIQGKSLPPSVRADMMKHPAYV
GVASELISYEATYAQVMTNILGTVIITRDLKGANELARQLQYRYRFVTLDGDVVNPGGAM
TGGTVNKQTSSLLSRTRELEEVTASFREIERKTIELEQRIQREKETIAQDEQQREHLYAE
LEANRMALQEEKSAWTELDLRKKHMDERLAVYRYERQTLEEEKQQLTARLHDVMQQLNEL
EKNIAHIDEQVQQWTEKKQLEQQSKEQMQEQLTALKVALAEKQEHVRNEEQHVRRLVEEW
EETKRTRAKMEEERHQLIQHMNEQTEDEQQLERICKEKTKQKEETIQLIASRREQRLQYQ
TKLEQLEKEIKELKRQHKQLTDTLKDEEVKLARFDMELDHLLNRLREEYKLSFEAAKEAF
PLHIPAQEARKKVKLIQLAIDELGTVNLGAIEEYERVFERHRFLTEQKEDLQRAKDTLYQ
VIDEMDDEMKRRFAVTFEQIRTQFARVFVELFGGGKADLKLTDPNDLLHTGVDIVAQPPG
KKLQHLSLLSGGERALTAIALLFAILNVRPVPFCVLDEVEAALDEANVQRYAKYLKKFSH
ETQFIVITHRKGTMEEADVLYGVTMQQSGVSKLVSVRLEEAAGKKG
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctcaaacgattagaagctatcggatttaaatcttttgcagatcgcatttcaatc
gattttgttccggggatgacggccatcgtcggtccgaacggaagcggaaaaagcaacatt
acagatgcgattcgttgggtgcttggggagcaatcggcgaagtcgcttcgcggggcaaaa
atggaagacgtcattttttcaggaagcgaatcgcgcaaaccgttaaacgtggctgaagta
acattaacgcttgataatagcgatcaatttttgccacttgaatacgaagaagtaagtgta
acaagacgtgtgtatcgctcgggagatagcgaattttttattaataaacagccgtgtcgc
ttaaaagatatcgttgatttatttatggattcaggcgttggtcgcgaagcgttttcgatc
attagccaaggaaaagtcgaagaaattttaagcagtaaaccggaagaccgtcgcatgatt
tttgaagatgcagccggtgtgttaaaatataaaatgaggaaaaaaaaggctgaacacaag
ttaagcgaaacagaagatcatttacaacgcgtgcaagatattttacatgagttaaaccaa
caactagaaccgttgaaacaacaagcgtccattgcgaaagaatatatcgagaaaaaagaa
caattacaaacatacgaagtcgggctaatcgtctatgaaattgaacagctacatgaaaaa
tgggaagcgttaaaagaacagctcgctatacatgaacaaaacgagatcgaattagcaacg
acgctacaaaaagaagaagcgcacatcgctgaattgcgccatgaactgacggcgctcgat
gagtcgattgacggcttacaacaagtgttattgcttgtgagcgaagagcttgaaaaaatg
gaaggaaaaaaacaagtattaaaagagcgaaaaaacaacgcccataagcaacaacaccaa
atggaacaaacggtggcccaactggctgagcgcgaacgtgtactggaagcgaccattgca
gaaaaaaagaagttgcttcaacagcttcaaacaaatgtgcaagcgcttcaagccgaatta
aaagaaaaaaataacgtgctttccgcttacggtccgaaagcagaggccgaaattgaacgg
ctaaaaagcgaatatatcgatctcgttcacgagcaagcgacgttgaaaaatgaacggacg
cacacggaagcacagttgcaaaaaaacgaagagaaacaacgacagctgatcgctgcaaac
gacgagcatattcgggcatacgagcaaatcgttcaacaatgggaacaaaagcaacagctt
gttcaccaattacagcagcgcatcgccgagcaagaagaagcagtaaaaacaaaagaacaa
caattagcggttcaaaaagaacaatatcgcaaaaaagaagcgacgttatatgaagcgtac
caatacgtacaaaaaatgaaatcaaaaaaagaaatgcttgaagcgatgcaacaagaatat
gctggatttttccaaggtgtgaaagaagtattaaaagcaaaagatcgccttccaggcatt
catggggctgtcgttgaactgatgacggtgccgtctgagctagagacagcgatcgaagtg
gcgcttggcggagcagcgcaacatatcgtcgtagagaacgaacaaagcgcacgcgaagcc
attcagtttttaaagcgacatgcgtacggacgagctacttttttaccgctcaacgtcatt
caaggaaaatcgcttcctccatctgttcgggcggatatgatgaaacatcccgcttacgtt
ggcgtcgcttccgaattaatttcgtatgaagcaacgtacgcgcaagtgatgacaaacatt
cttggaacggtcattattacgcgcgacttaaaaggagcgaatgagcttgcgcgccaactg
caataccgctatcgtttcgtcacgcttgacggagatgttgtgaatcctggtggagcgatg
acgggaggaacggtaaacaaacagacgagttcattattaagccgcacacgtgaacttgaa
gaagtgacagcaagttttcgcgaaatcgaacgaaaaacgattgaactcgaacagcgcatc
cagcgtgaaaaagagacgattgcccaagacgaacagcaacgagagcatctttatgcggaa
ctggaagcaaaccgtatggcgctgcaagaagaaaaaagcgcatggacggaactagatctc
cgaaaaaaacatatggatgagcgactagctgtgtatcgctatgaacgacaaacgcttgaa
gaagaaaaacaacagctgaccgctcgacttcacgatgtcatgcagcagcttaatgagtta
gagaaaaacatcgctcatattgacgaacaagtacagcaatggacagaaaaaaaacagctc
gaacaacaatcaaaagaacaaatgcaagaacagctgaccgctttaaaagtcgcgcttgca
gaaaagcaagaacatgtaagaaatgaagaacaacatgtgcggcgacttgtcgaagaatgg
gaagaaacgaagcgaacgcgcgcaaaaatggaagaagagcggcatcaacttattcagcat
atgaacgagcaaacggaagatgaacaacagctcgaacgaatatgcaaagaaaaaacgaaa
caaaaagaagaaacgattcaactgatcgctagccgccgtgaacaacgactacaataccaa
acgaagcttgaacagctcgaaaaagaaataaaagagctgaaacgtcaacataaacagcta
acagatacgttaaaagacgaagaagtgaagctcgctcgttttgatatggagttagatcac
ttgttaaatcgacttcgtgaagaatataaactatcgtttgaagcggcgaaagaagcgttc
ccacttcacatcccagcgcaagaagcgcggaaaaaagtaaagctcattcaattggcgatt
gatgagctcgggacggtgaaccttggcgcgattgaagaatatgaacgcgtatttgagcgc
catcgctttttaacggaacaaaaagaagatttacaacgcgcgaaagatacactttatcaa
gtgattgacgaaatggacgatgaaatgaagcgaagatttgcggtgacgtttgaacaaatt
cgtacgcaatttgcgcgtgtgttcgtcgaattgtttggaggaggaaaagcggatttaaag
ctgaccgatccgaacgatttacttcatacaggtgtcgatattgtcgcacagccgccgggc
aaaaaactgcaacatttaagtttattatcaggcggtgaacgagcgctgactgccattgcg
cttttatttgctattttaaacgttcgacctgttccgttttgcgtgctcgatgaagtggaa
gccgcactagatgaagcgaacgtgcaacgatatgcgaaatatttaaagaaatttagccac
gaaacacaatttatcgtcattactcatcgaaaaggaacgatggaagaagcagacgtattg
tacggagtaacgatgcaacaatcaggcgtatcgaaacttgtttctgttcgattggaagaa
gcagctggaaagaaaggatga

DBGET integrated database retrieval system