KEGG   Anoxybacillus gonensis: AFK25_06295Help
Entry
AFK25_06295       CDS       T04000                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00010  Glycolysis / Gluconeogenesis
agn00620  Pyruvate metabolism
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFK25_06295
   00620 Pyruvate metabolism
    AFK25_06295
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AFK25_06295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKS38167
UniProt: A0A0A2SJ73
LinkDB All DBs
Position
complement(1179603..1181123)
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGSLITFKKRYENFIGGEWVPPIDGEYFENISPVTGQVYCEVPRSKAADIEL
ALDAAHAAKETWGRTSVAERARLLNKIADRMEENLDMLAVAETWENGKPIRETRAADIPL
AIDHFRYFAGCIRAEEGTLAELDDDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIQDLLPKGVINVVNGFGLEAGKPLASNPRIAKVAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVVAKDDEFFDKALEGFTMFALNQGEV
CTCPSRALIEESIYDVFMERALERVKQIKQGNPLDTNTMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGDLQGGYYVKPTVFKGHNRMRIFQEEIFGPVVSVTTFKDKDEAL
AIANDTLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKMSGIGRET
HKMMLEHYQQTKNLLVSYSPKKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgctcagcctgggcaacctggctcactcattacatttaaaaagagatacgaa
aatttcatcggtggagaatgggtacctcccattgacggtgaatattttgaaaatatttcg
cccgttactggacaagtatattgcgaagttcctcgctcgaaagcagctgatatcgaatta
gcactcgatgctgctcatgcggcgaaagaaacatggggacgcacatctgtcgctgaacgt
gcacgcctattaaataaaatcgcagaccgaatggaagagaatttagacatgcttgcggtc
gcagaaacatgggaaaacggaaaaccgattcgtgaaacgcgtgccgctgacattccgttg
gcaattgatcatttccgctattttgcgggttgcattcgcgctgaagaaggcacgcttgca
gagcttgacgatgataccgtcgcttatcatttcaaagagccgcttggagttgtcggacaa
attatcccttggaacttcccaattttaatggcagcgtggaaactcgcacctgctttagct
gctggtaactgcgtcgtattaaagccagcagaacaaactccaacatcgattcttgtgcta
atcgagttaattcaagacttattaccaaaaggtgttatcaacgtcgtcaacggatttggt
cttgaagctggcaaaccgctcgcttctaacccacgaattgcgaaagttgcctttactggc
gaaacaacaaccggacgtttaattatgcaatatgcatctcaaaatttaattccggttacg
cttgaactcggcggaaaatcaccaaacattttcttcgctgacgttgttgcgaaagatgat
gaatttttcgataaagcattggaaggttttacgatgtttgcattaaatcaaggggaagtt
tgtacatgcccttcacgcgcgttaatcgaagaatcgatttacgatgtgtttatggagcgg
gctttagaacgagtgaagcaaattaaacaaggaaatccgctcgatacgaatacgatgatt
ggcgctcaagcctcatctgaacagctagagaaaattttgtcatacatcgacatcggtaaa
caagaaggggctgaacttctaatcggcggcgagcgcaatatgttagaaggagacttacaa
ggtggttattatgtcaaaccaaccgtctttaaagggcataatcgtatgcgcatcttccaa
gaagaaattttcggtccggttgtatctgtcaccacatttaaagataaagatgaagcgtta
gcgatcgcaaatgacacattatacggactaggtgctggagtatggacgcgcgatattaat
acagcgtatcgttttggacgtggcattcaagctggacgtgtatggacaaattgttaccac
gcatatcctgcgcatgcggcatttggtggatataaaatgtcaggaatcggacgtgaaacg
cacaaaatgatgctcgaacattatcaacaaacgaaaaacttacttgttagctactcaccg
aaaaaacttggatttttttaa

DBGET integrated database retrieval system