KEGG   Anoxybacillus gonensis: AFK25_08675Help
Entry
AFK25_08675       CDS       T04000                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00564  Glycerophospholipid metabolism
agn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFK25_08675
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AFK25_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 NAD_binding_8 GIDA Pyr_redox GMC_oxred_N Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: AKS38629
UniProt: A0A0A2SYM7
LinkDB All DBs
Position
complement(1662343..1663995)
Genome map
AA seq 550 aa AA seqDB search
MMFSAKQRMEIIEEMSKTTYDVLVIGGGITGCGIALDATTRGMKTALIEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPIHRGGTFGKWSTSI
GLWVYDHLARVKKEERRTMLSPYETLQKEPLIKQDGLLGGGYYVEYRTDDARLTIEVIKK
AVECGAHAVNYVKAESFLYDENGRINGVTCCEQTTGKTFTIYAKKIVNAAGPWVDILREK
DGSHVGKELRLTKGVHIVVDQAHFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTFYDG
DRVHPKMTSDDRDYLLRAIRYMFPTVHLTEQHIESSWAGLRPLIYEEGKDPSEISRKDEV
WQSPSGLITIAGGKLTGYRKMAETVVDLIAKQLGGTYPPCQTKHLPISGGDVGGASRWHT
FMCEKIAEGMACGLTEQQAKRLVQRYGTNVDRLFAFASTYNREEIALPIDWYVMCIYALE
CEMTVTPLDFFIRRTGALFFDIQAVRQLKEAVVTLMQSYFHWTEEERNKYEQQVNVALHD
AVIPSNEAQR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttcagcgaaacaacgaatggaaataatcgaggaaatgagtaaaacgacgtat
gatgtgcttgtgattggcggaggtattaccggttgtggcatcgcgctcgacgcaacgacg
cgcggaatgaaaacagcgctcattgagatgcaagattttgcggctggcacgtcaagtcgt
tcgacgaaactcgttcatgggggattacgttatttaaaacagttcgaagtaaaaatggtc
gcagaagtaggaaaagagcgggccattgtatatgaaaacggtccgcatgttacgacacca
gaatggatgttattgccgattcatcgcggtggcacgttcgggaaatggagtacgtctatc
ggattatgggtgtatgatcatttagcgcgcgtcaaaaaagaggaacggcgaacgatgtta
tcaccatatgaaacgttgcaaaaagagccgttaattaaacaagacggattgcttggcggc
ggttattacgttgaatatcgaacagatgatgcacgattgacgattgaagtaataaaaaaa
gcggtggaatgcggagctcacgcagtcaattatgtaaaagcagaatcgtttttgtacgat
gaaaatgggcgaatcaatggagtgacatgttgcgagcaaacgacagggaaaacgtttacg
atatatgcgaaaaaaattgtcaatgcggcagggccatgggtcgatatattacgtgaaaaa
gatggctcacacgtcggaaaagaattgcgcttaacaaaaggggtgcacattgtcgttgat
caagcacatttcccgcttaagcaagcggtatattttgatacgcctgacggtcgcatggta
tttgcgatcccgcgcgaagggaagacgtacgtcggcacgacagatacgttttatgacgga
gatcgcgtccacccgaaaatgacaagcgatgatcgcgactatttactgcgcgccattcga
tacatgttcccgaccgttcatttaacggaacaacatattgaatcaagttgggctggattg
cgtccactcatttatgaggaagggaaagatccatctgaaatttcccggaaagatgaagtt
tggcaatctccatctggtctgattacgatcgctgggggaaagttaacaggctatcgcaaa
atggctgaaacggttgttgatttgatcgctaaacagctaggtgggacgtatccaccgtgt
caaacgaaacatttgccgatttccggtggggacgttggcggtgcgagccgatggcatacg
tttatgtgtgaaaaaatcgctgaaggaatggcttgcggcttgacggaacaacaagcaaaa
cggctcgtgcagcgatacggtacgaatgtcgatcgtttattcgcttttgctagcacatac
aatcgagaggaaatagctcttcctattgattggtatgtgatgtgcatatatgcacttgaa
tgcgaaatgacggtaacaccgctcgactttttcattcggcgtaccggagcgctctttttt
gacattcaggcggttcgtcagttaaaagaagcagtcgttacgttgatgcaatcgtatttt
cattggacagaagaggagcgaaataaatacgaacagcaagtaaacgttgcgcttcatgat
gccgttattccgagcaatgaagcacaacgttag

DBGET integrated database retrieval system