KEGG   Anoxybacillus gonensis: AFK25_11640Help
Entry
AFK25_11640       CDS       T04000                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00010  Glycolysis / Gluconeogenesis
agn00030  Pentose phosphate pathway
agn00051  Fructose and mannose metabolism
agn00052  Galactose metabolism
agn00680  Methane metabolism
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01120  Microbial metabolism in diverse environments
agn01130  Biosynthesis of antibiotics
agn01200  Carbon metabolism
agn01230  Biosynthesis of amino acids
agn03018  RNA degradation
Module
agn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFK25_11640
   00030 Pentose phosphate pathway
    AFK25_11640
   00051 Fructose and mannose metabolism
    AFK25_11640
   00052 Galactose metabolism
    AFK25_11640
  09102 Energy metabolism
   00680 Methane metabolism
    AFK25_11640
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AFK25_11640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:agn01009]
    AFK25_11640
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:agn03019]
    AFK25_11640
Enzymes [BR:agn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFK25_11640
Protein phosphatases and associated proteins [BR:agn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFK25_11640
Messenger RNA biogenesis [BR:agn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AFK25_11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AKS39218
UniProt: M5R5Y5
LinkDB All DBs
Position
complement(2226096..2227055)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVYGIYHGYAGLIAGNIKKLEIGDVGDI
IHRGGTMLYTARCPEFKTLEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGYPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMDEIVARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIIEAL
AQKHTVDQKMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattggtgtgcttacgagcggtggcgattcaccaggaatgaatgcggccatt
cgcgcagttgttcgaaaagcaatttaccatggattagaagtgtacggcatttaccacgga
tatgcggggttaattgccggaaacattaagaaacttgaaatcggggatgttggcgatatt
attcatcgtggtggaacgatgttatatacggcccgctgcccagaatttaaaacgttagaa
ggacagttaaaaggaattgagcaattgaaaaagcatggtattgaagggctcgttgtgatc
ggtggtgacggttcgtatcaaggggcgaaaaaattaacagaacacggctatccttgcgtc
ggcgtgccgggaacaattgataatgacattccaggaacggattttacgatcggttttgat
acagcattgaatacggttattgatgcaattgacaaaattcgtgatacagcgacatctcat
gagcgtacatacgtcattgaagtcatggggcgtcatgctggggacattgcgctttgggcc
ggtcttgctggcggagcggagagcattttaattccagaagcagattatgatatggatgaa
attgttgcgcgtctgaaacgtggacatgaacgcgggaaaaaacatagtattattattgtt
gctgaaggtgtcggtagcggtgtggaatttggtaagcgaattgaagaagcaacaggcttt
gaaacgcgtgtaactgtgttaggtcacgtccaacgtggtggttcaccgacagcgtttgac
cgtgtgcttgcaagccgtttaggtgctcgtgccgtagaattgttgcttgaaggaaaaggc
ggacgttgtgtcggcattcaaaacaatcaacttgttgatcatgacatcattgaagcgtta
gcacaaaaacatacagttgaccaaaaaatgtaccaattgtccaaagagctttcaatttaa

DBGET integrated database retrieval system