KEGG   Anoxybacillus gonensis: AFK25_12625Help
Entry
AFK25_12625       CDS       T04000                                 

Definition
(GenBank) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00260  Glycine, serine and threonine metabolism
agn00270  Cysteine and methionine metabolism
agn00300  Lysine biosynthesis
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01120  Microbial metabolism in diverse environments
agn01130  Biosynthesis of antibiotics
agn01230  Biosynthesis of amino acids
Module
agn_M00017  Methionine biosynthesis, apartate => homoserine => methionine
agn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFK25_12625
   00270 Cysteine and methionine metabolism
    AFK25_12625
   00300 Lysine biosynthesis
    AFK25_12625
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     AFK25_12625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT GFO_IDH_MocA ACT_4 DXP_reductoisom Sacchrp_dh_NADP DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AKS39386
UniProt: A0A0A2T006
LinkDB All DBs
Position
complement(2405622..2406923)
Genome map
AA seq 433 aa AA seqDB search
MVKSVSVGLLGLGTVGSGVVKIIKNHQDKLMHQIGCPVEIKKVAVRDRDKKRDVVLPESV
LTTNVEEVIHDPDIDVVIEVMGGIEETRRYILQALKNGKHVVTANKDLMALYGTELLSVA
SEHGCDLFYEASVAGGIPILRSLVDGLASDRITKMMGIVNGTTNYILTKMSKFNRKYEEV
LAEAQALGYAEADPTSDVEGLDAARKMAILARLGFSMNIDLQDVYVKGITGITEEDLNYS
KRLGYTMKLIGIAHRDGEKVEVSVQPTLLPDTHPLASVNDEYNAVYVYGEAVGETMFYGP
GAGSLPTATSVVSDLVAVMKNMRLGVNGRSAVTPQYDKQLKDDSEIYSKYFLRIHVKDQV
GAFAKITSLFSERGVSFEKILQLPLKQKDLAEIVLVTHQASLKDYRDVLQQLRDLEVVEE
VKSSYRVEGEGAL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaagcgtatcagttggattgttaggattaggaacggttggcagtggagttgtg
aaaattattaaaaatcatcaagataaattgatgcaccaaattggttgccctgttgaaatc
aaaaaagttgctgtgcgtgatcgcgataaaaaaagagatgtcgttttgccagagtcagtc
ttaacgacaaacgtagaagaagtcattcatgacccagacatcgatgtcgtcattgaagtc
atgggaggcattgaagaaacgcgacgatatatattacaggcattaaaaaacggaaaacat
gttgtgacggcaaataaagacttaatggcgctgtatggaacagagttgctttccgtcgca
tctgaacacggttgcgatttgttttatgaagcaagtgtcgcaggaggaattccgatttta
cgcagccttgtagacggattagcttctgatcgaattacaaaaatgatgggcatcgtaaac
gggacaacaaactatattttaacaaaaatgagtaaatttaatagaaaatatgaagaagta
ttagcagaagcgcaggcgctcggttatgctgaggcagatccgacatcagatgtagaagga
ctagatgcagcaagaaaaatggcgattttagctcgccttggtttttcgatgaatattgat
ttgcaagatgtatacgtcaaaggaattactggaattacagaagaagatttaaattacagc
aaacgactcggttatacgatgaaattaatcggtattgcccatcgagacggagagaaagta
gaagtgagtgtgcaaccgacattgttgccagacacacatccacttgcgtctgtcaatgat
gagtataatgccgtttacgtttacggtgaagcggttggagagacgatgttctatggtccg
ggagcaggaagcttaccgacagcaacatccgttgtgtcggacttagttgctgtaatgaaa
aatatgcgccttggggtcaatggaagaagcgcagttaccccacaatacgataagcagtta
aaagacgatagcgaaatatactcgaaatatttcttacgtattcatgtaaaagatcaagtt
ggagcgtttgcgaaaattacatcacttttttcagaacgtggagtaagttttgaaaaaatt
ttacaattacctttaaaacaaaaagacttggcagaaattgttcttgttacgcatcaagca
tctttaaaagattatcgtgatgtgttgcaacagttgcgcgatttagaagttgtcgaagaa
gtgaaaagttcgtatcgagtagaaggggaaggtgcgctgtaa

DBGET integrated database retrieval system