KEGG   Anoxybacillus gonensis: AFK25_12810Help
Entry
AFK25_12810       CDS       T04000                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00071  Fatty acid degradation
agn00362  Benzoate degradation
agn00650  Butanoate metabolism
agn01100  Metabolic pathways
agn01120  Microbial metabolism in diverse environments
agn01200  Carbon metabolism
agn01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AFK25_12810
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK25_12810
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK25_12810
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AFK25_12810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKS39423
UniProt: M5QRA3
LinkDB All DBs
Position
complement(2436907..2439285)
Genome map
AA seq 792 aa AA seqDB search
MRIKKAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPKELTAEEQAKGWTLEHKQVRNRIV
NQAVERLLKQKPAPLMSKENVALIEVGNFEDDFRRLAECDWIIEVVVERLDVKKSVFEKV
DEVRKQGSIVSSNTSGISIEAMAEGRSDDFKKHFLGTHFFNPPRYLKLLEVIPTKHTDPS
VVAFMKQFGENVLGKGVVLAKDTPNFIANRIGTYGLLVTVREMMKGGYSVGEVDSVTGPL
IGRPKSATFRTLDVVGLDTFIHVANNVFEKVEGEEKEVFTVPSFMKTMVEKGWLGSKSGQ
GFFYKKGKDIFELNYETLEYEPTKKLKAPSVEMSKQAKGTANKLKALVYANDRAGQLLWN
ILSPTLLYSAELLGEIADDIVAIDRAMKWGFGWELGPFETWDAIGVKQSVEKMKAEGRQV
PSWVEQMLENGHETFYKHEHGRVSYYDRGQYKPVEENEKVIHIQRLKEQKGVIKKNSGAS
LIDLGDDVALLEFHSPNNAIGFDIVQMINYALEEVDRNYKGLVIGNQGKNFCVGANLAMI
LMEAQDDNYFEIEMVVRQFQQAMMNIKYSAKPVVVAPFAMTLGGGTEICLPASRIQASAE
TYMGLVEVGVGLIPGGGGNKELYIKHLSGMPNGVEFDLQKVANKVFETIAMAKVSTSAAE
ARELNFLNGQDGISINGDHLIHDAKQAVLALYESGYKPPVRKKIPVVGETGYATLLLGAQ
GMYHSGYISEHDLKIAKKLAYVIAGGSVPYGTEVDEQYLLDLEREAFLSLVGEPKTQARM
QHMLVKGKPLRN
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattaaaaaagcagctgttctcggttccggtgtcatgggatcggggattgcggcg
catttagcgaacgtcggcattccgacattgttgttagatatcgtaccgaaagagttgaca
gcggaagaacaagcgaaagggtggacgcttgagcataaacaagtacgcaatcgcattgtc
aatcaagcggttgaacgtttgttgaaacaaaagccagctccgctcatgtcgaaagaaaat
gtagcgcttattgaagtcggtaactttgaagacgattttcgccgcttagcagaatgtgac
tggattattgaagtcgttgttgagcggcttgatgtgaaaaaaagtgtgtttgaaaaagtg
gatgaagtaagaaaacaaggaagtatcgttagctcgaacacatctggcatttccattgaa
gcaatggcggaaggacgctcggatgattttaaaaagcactttttaggcacgcacttcttt
aatccgccacgttatttaaaattgctagaagtcattccgacaaaacataccgatccatcc
gttgttgcgtttatgaaacaatttggtgagaacgtgctcggaaaaggagtcgttcttgcg
aaagatacgccaaactttattgctaatcgtatcggaacgtacggcttgcttgtaaccgtg
cgcgaaatgatgaaaggtggctatagcgtaggcgaagtcgattctgtgacaggtccttta
attggccgcccaaaaagcgccacgttccgcacgcttgatgtcgttggattagatacgttt
attcatgtggcgaacaatgtgtttgaaaaagtagaaggtgaagaaaaagaagtatttact
gttccatcttttatgaaaacaatggttgaaaaaggatggctcggcagtaaatctggtcaa
ggatttttctataagaaaggaaaagacatttttgaattaaattacgaaacgcttgagtat
gaaccgacgaagaaattaaaggcaccgtctgttgaaatgagcaaacaagcaaaaggaaca
gcgaataaattgaaagcgcttgtatatgcgaacgatcgggcagggcaattgctttggaac
attttaagtccaacgttattatattcggctgagctgcttggagaaatcgcagatgacatc
gtagcgattgaccgtgcgatgaaatggggttttggctgggagctcggtcctttcgaaacg
tgggatgcgatcggtgtgaagcagtctgttgaaaaaatgaaagcggaaggtcgccaagtt
ccatcatgggtagaacagatgttggaaaacgggcatgaaacgttttataaacacgaacat
ggccgagtatcgtactacgatcgtgggcaatacaaaccggttgaagaaaacgaaaaagtc
atccatattcaacgcttaaaagaacaaaaaggggtgattaagaaaaatagtggtgcaagc
ttgatcgacctcggtgacgatgtggcgttacttgagtttcattcaccaaacaatgcgatc
ggttttgatattgttcaaatgattaactatgcgttagaagaagttgaccgcaactataaa
ggacttgtcatcggaaaccaagggaaaaatttctgcgtcggtgcgaaccttgcgatgatt
ttaatggaagcgcaagatgacaactattttgaaatcgaaatggtcgttcgtcaattccaa
caagcgatgatgaatattaaatatagcgcaaaaccggttgtcgttgccccatttgcgatg
acgcttggcggtggaacggaaatttgcttgccagcttcacgcattcaagcatcggccgaa
acgtatatgggacttgtcgaagtcggcgttggtctcattcctggtggcggtggaaataaa
gagctgtatattaaacatttgagcggcatgccgaacggtgtggaatttgatctacaaaaa
gttgcaaataaagtgtttgaaacaattgcgatggcgaaagtatcaacgtctgccgcggaa
gcgcgtgaattgaatttcttaaacgggcaagatggcatttcaatcaatggcgatcatctc
attcatgacgcaaaacaagcggtgttagcgttatatgagagcggatacaagccaccggtg
cgtaaaaaaattccggttgtcggagaaacaggctatgcgacgttgttgctcggtgcgcaa
ggaatgtatcattccggttacatttcggagcatgatttaaaaatcgcgaaaaaacttgct
tacgtcattgctggtggaagcgtaccgtacggaacagaagtggacgaacaatatttgctt
gatttagagcgggaagcatttttaagccttgtcggcgagccgaaaacacaagcgcgcatg
caacatatgcttgtgaaaggaaaaccgttaagaaactaa

DBGET integrated database retrieval system