KEGG   Anoxybacillus gonensis: AFK25_12980Help
Entry
AFK25_12980       CDS       T04000                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00340  Histidine metabolism
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01230  Biosynthesis of amino acids
Module
agn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AFK25_12980
Enzymes [BR:agn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     AFK25_12980
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AFK25_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239
Motif
Other DBs
NCBI-ProteinID: AKS39456
UniProt: M5R7Y7
LinkDB All DBs
Position
complement(2468061..2468675)
Genome map
AA seq 204 aa AA seqDB search
MNIRFNEQGLVPAIVQDAHSKEVLTLAYMNEQSLQKTLETKETWFYSRSRQELWHKGETS
GNVQKVVDIRYDCDADALLILVEPKGPACHTGEYSCFHHRLQGEKPVVKPDRFAVLNVLE
SVIAEREAKRPEGSYTTYLFEKGIDKIAKKVGEESAEVIIAAKNRSKEELRWEVADLLYH
LLVLLREQRVSLDDVLSVLAERHR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgatttaatgagcaagggcttgtgccggcaatcgtacaagatgcacatagt
aaagaagtgttgacattagcatatatgaacgagcaatcgttacaaaaaacgttagaaacg
aaagaaacatggttttacagccgctcgcggcaagagttatggcataaaggagaaacgtcc
ggaaacgtacaaaaagttgttgatattcgctacgactgtgatgcagatgcgcttcttatt
cttgttgagccgaaaggaccggcatgccacacaggagagtactcttgttttcatcatcgg
ttgcaaggtgaaaagcctgttgttaaaccagatcgttttgcggtgctaaatgtgttagaa
tcggtcattgcggagcgtgaagcgaaacgtccagaaggatcgtatacaacatatttattt
gaaaagggaattgataagatcgcaaaaaaagttggagaagaatccgcagaagtcattatt
gcagcaaaaaatcgttcaaaagaagaactgcgatgggaagtagccgatttattatatcat
ttgctcgttttgttgcgtgagcagcgcgtatcgctcgatgatgtgctttctgtattagcg
gagcgtcatcgctga

DBGET integrated database retrieval system