KEGG   Anoxybacillus gonensis: AFK25_13235Help
Entry
AFK25_13235       CDS       T04000                                 

Definition
(GenBank) hypothetical protein
Organism
agn  Anoxybacillus gonensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKS39505
UniProt: A0A0A2SHI5
LinkDB All DBs
Position
complement(2513574..2514128)
Genome map
AA seq 184 aa AA seqDB search
MNMPQIQIRTVKAMLGLNIQKPTQHIEQPKAELYIEQPPASLHIYKQPARLTIDQSRAWR
DMGLIGPLESTSRFAKEGRQALLEGIARQAEEGERLMRIEHGGNPIAEIATGKGMRPYRQ
LGITFIPSVDSVDVHYEPARVEIEVEKNKPIIQAKVNPPIHEYKQGKVSGHMIQYPSIQI
DVKY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgccgcaaatacaaattcgtactgtaaaagcgatgctcggtttgaacatacaa
aaaccaacacagcatattgagcagcctaaagcagaattatatatcgaacagccgccggct
tcgctccatatttataaacaacctgctcgtctcaccattgatcaatcaagggcatggaga
gatatggggctaattggtccgcttgagtcgacgagccggtttgctaaagaaggacgccaa
gctttgcttgaggggattgctagacaagcggaagaaggagaacggttgatgcgaatcgag
catggcggtaatccgatcgcagaaatcgcaacaggaaaaggcatgcgcccatatcgccag
cttggaattacatttattccatctgtagatagtgtagatgttcactatgaaccagcgcgc
gtggagatcgaagtggaaaagaataagccgattatccaagcgaaagttaatccgcctatt
catgagtataaacaagggaaagtttctggtcatatgattcaatatccatctatacagatt
gatgtgaagtattaa

DBGET integrated database retrieval system