KEGG   Anoxybacillus gonensis: AFK25_13250Help
Entry
AFK25_13250       CDS       T04000                                 

Definition
(GenBank) hypothetical protein
Organism
agn  Anoxybacillus gonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN Phycobilisome T2SSK MutS_III DUF2508 APG6_N DUF2779 CCDC85 DNApol3-delta_C
Motif
Other DBs
NCBI-ProteinID: AKS39508
UniProt: A0A0A2SIQ8
LinkDB All DBs
Position
complement(2516621..2517100)
Genome map
AA seq 159 aa AA seqDB search
MSIQQLVGVLRDYIETHQQLKSSANRKTEALKKGDFAALDDIVREEQVHVAMLNQLEKKR
ARIVTQITGIDGEQTVESCLRYADEQEQKILHELRKQLLQHIEELKRINELNQQLIEQSL
QFVCVMLDALHPQRKDIQYRANNEPTSYEERQSIFDSKV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
ttgtctattcagcaacttgttggtgtgttgcgtgattatatcgaaacgcatcaacaatta
aaaagtagtgcaaacagaaagacggaagcgctaaaaaaaggggacttcgctgctttagat
gacattgtaagagaagaacaagtacacgtagcgatgcttaatcagttagaaaaaaagcgt
gcgcgaatagttacgcaaatcacagggattgatggagagcaaacagtagaatcatgtttg
cgttatgcagatgagcaagaacagaagattctccatgagttgcgaaagcaattattacag
catattgaagaacttaaacggataaatgagctgaatcaacaacttattgagcaatcgtta
cagtttgtttgcgtcatgcttgatgcgttgcatccgcaaagaaaagatatacaatatcgt
gctaacaatgagccaacttcttatgaggagcgacagtctatttttgattcgaaagtgtaa

DBGET integrated database retrieval system