KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACL155WHelp
Entry
AGOS_ACL155W      CDS       T00167                                 

Definition
(RefSeq) ACL155Wp
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago03030  DNA replication
ago03410  Base excision repair
ago03420  Nucleotide excision repair
ago03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AGOS_ACL155W
   03410 Base excision repair
    AGOS_ACL155W
   03420 Nucleotide excision repair
    AGOS_ACL155W
   03430 Mismatch repair
    AGOS_ACL155W
Enzymes [BR:ago01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AGOS_ACL155W
    6.5.1.6  DNA ligase (ATP or NAD+)
     AGOS_ACL155W
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AGOS_ACL155W
DNA replication proteins [BR:ago03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AGOS_ACL155W
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AGOS_ACL155W
DNA repair and recombination proteins [BR:ago03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AGOS_ACL155W
   NER (nucleotide excision repair)
    Other NER factors
     AGOS_ACL155W
   MMR (mismatch exicision repair)
    Other MMR factors
     AGOS_ACL155W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF1685
Motif
Other DBs
NCBI-GeneID: 4619369
NCBI-ProteinID: NP_983249
UniProt: Q75CS4
LinkDB All DBs
Position
III:81488..83581
Genome map
AA seq 697 aa AA seqDB search
MSAPKKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPEL
ADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCAD
FMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSY
RECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTA
CQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTF
CQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEY
KYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDN
EKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLK
VVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLK
KDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQ
SLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGI
SLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSSG
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctccaaagaagcaggccacattgggccgattcttcactgcgctgaagaggcct
caagatggagcgacggcagcagcgacggtcaagaaatcgaaggtagaggctgccgagtgc
ctagcggcaccggcaggccatgaacaggacgccgaggtgaagaacagcctccccgagctt
gcagataagcccgcgccggggggggtgctgccacaggctgccagcgccgtgccacgcgca
caaagttctccggttaagcctgcagcaagcaccagcgtgatgtatgcagacctgtgcgct
gtgtttgaagctgtggaggctacttcttcgaggctgtcgatcaccaagttatgcgcggac
ttcatgtatagcgtgctaaagtgcgacccagggcacttgatcccggtgacatacttgttc
atcaaccggctgggtcccgactacgagcctgggctagagctgggactgggcgagggcata
ctcatcaaaaccatcagcgatgcatgtggcaagtctgcggctcaagtgcgaagcagctac
cgcgagtgcggcgacctgggcaccgtcgcgcaacaggcgcgtgtggtacagccgacgatg
ttcaagccaaagcctctcaccgtgagggacgttttcagcacgcttcaggcaattgcacag
gcagagggtaaggactcgcaaggcaagaagattcgccttatcaagaaaatgctgacggcc
tgccaaggaatggaggcgaagtaccttatcaggtcgctagaatcgaaactgcgtatcgga
ctagcggaaaaaactgtccttgtagcgctttcgaaagccatcctgactcatgagcacgat
ggaaaggagccatctccggaacaagttgatgccgcagaggcgcttgtccgtgacactttc
tgtcaggtccctaactatgagatgataatcaacgctgcgctgcaatacggtataatgaat
cttccgcagcactgcgtgcttacaccaggcattcctctgaaacccatgttagcgaaacct
acgaagtcgatcactgaggttcttgatcggttccagggccagcgcttcacttgtgaatac
aagtacgacggagagcgcgctcaggttcatctgatggaggacggtaccatacggatatac
tcgcgcaatagtgaaaacatgaccgagcgttatcccgagatacaatttcaccaatttctg
gctaacccacagactacacgcagtctcatcatagactgcgaggctgtagcctgggacaat
gagaaacaaaagattctgcctttccaggtgctcagcacacggaaacggaaaggcgtagag
cttaaggatgtcaaggtgcgcgtgtgcctctttgcgtttgacttgctttatctgaacggc
gagtctctgttgaagtgttcgttagctgaccgccggaaacatttatattctgtgctaaag
gtggtgccaggcgagctgcagtttgcgaacgaaatcacaacgatggagctcagcgagctg
cagacgtatcttgaacaatctgtaagcgcctcatgcgaagggttgatggtcaagatgttg
gatggagaggagtctcagtacgagcccagcaagcgctcgcgaaactggctcaaactgaag
aaggactatctagagggcgtcggagattccctcgatctcgcagttctaggtgcatactat
ggacgcgggaagcgtactggcacctacggcggctttctgctgggctgctataatccagac
cttgaggagtttgagacatgctgcaaaattggcaccggtttcagcgaggaggtcctccaa
tccctacatgcgcagctcaaggacaccgtgatagctgccccccgcggcgacgtctcttac
gacgattcaagcccaccagatgtctggttcgagccggcaatgctttttgaggtcctcact
gctgacctctctctctcgcccgtatacaaagccggtcgtgacgtctatggaaagggaatc
tcgttgcgcttcccccgttttctgcggatccgcgaagacaagagcgtcaccgatgccacc
agttccgaccagattgtggagttctaccagaggcaagcaaactcttctggctag

DBGET integrated database retrieval system