KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR052WHelp
Entry
AGOS_ACR052W      CDS       T00167                                 

Definition
(RefSeq) ACR052Wp
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00020  Citrate cycle (TCA cycle)
ago00190  Oxidative phosphorylation
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
Module
ago_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ago_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ago_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGOS_ACR052W
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AGOS_ACR052W
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AGOS_ACR052W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 4619580
NCBI-ProteinID: NP_983455
UniProt: Q75C64
LinkDB All DBs
Position
III:450772..452673
Genome map
AA seq 633 aa AA seqDB search
MLSVTRTAPGVRTRALRLFSSGRAASLAAVGAGAPQAKYHIVDHEYDCVVVGAGGAGLRA
AFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHGDDWKWHMYDTVKGSDWLGDQ
DSIHYMTREAPASIIELENFGMPFSRNDEGRIYQRAFGGQSKEYGKGGQAYRTCAVADRT
GHAMLHTLYGQALSHNTHFFVEYFAMDLLTHNGEVVGVIAYNQEDGTVHRFRAHRTVMAT
GGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGG
FLLNSEGERFMERYAPTAKDLACRDVVSRAITMEIREGRGVGPEKDHIHLQLSHLPPSVL
KERLPGISETAHIFAGVDVTKEPIPVLPTVHYNMGGIPTRWTGEALTIDEETGEDKVIPG
LLACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVADSLQPGLPHKPLPADLGKESIA
NLERMRTASGPLTTSQIRLNMQKAMQKDVSVFRTQQTLDEGVHNVSAIDETLKDVGTSDR
SMIWNSDLVETLELQNLLTCAVQTAKSAAERKESRGAHAREDFPERNDEEWMKHTLSWQH
ASGAPVEIKYRNVITTTLDETECPPVPPTVRAY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgttactcgaaccgctcctggcgtgcgtacgcgggcgctcagactgttcagc
agcggccgggccgcgtcgctcgccgccgttggcgcgggcgcgcctcaggccaagtaccac
atagtggaccacgaatacgactgtgtagttgtcggcgccggtggggccgggttgcgtgca
gctttcgggttggctgaggcaggttacaagacggcgtgcatttccaagctattcccaacg
cggtcgcacacggttgcagcgcagggcgggattaatgctgcgctgggaaacatgcacgga
gacgactggaagtggcacatgtacgacacggtgaagggctccgactggctgggtgaccag
gactcgatccactacatgacgcgggaggcgcctgcgtcgatcattgagctggagaacttc
gggatgccgttctcgcggaatgacgagggccggatctaccagcgcgcgttcggcgggcag
tcgaaggagtacggcaagggcgggcaggcgtaccggacgtgcgcggtagcggaccggacc
gggcacgcgatgctgcacacgctgtacgggcaggcgctgagccacaacacgcacttcttc
gtggagtactttgcgatggaccttttgacgcacaacggcgaggtcgtgggtgtgatcgcg
tacaaccaggaggacggcactgtgcaccgcttccgcgcgcaccgcacggtgatggcaacg
ggcggctacgggcgcgcgtacttctcgtgcacgtctgcacacacctgcacgggtgacggt
aacgcgatggtgtctcgtgccgggttcccgctgcaggatttggagttcgtgcagttccac
ccctccggtatctatggatccggctgtctgatcaccgagggtgcccgtggtgagggtggc
ttcctgctgaactctgagggtgagcgtttcatggaacgttacgcgccaaccgccaaggac
ctggcctgccgtgacgtcgtgtcgcgggccatcaccatggagatccgcgagggccgtggt
gtgggtccggagaaggaccacatccacctgcagctatcgcacctgcctcctagcgttttg
aaggagcgcttgccgggtatctcggagactgcccacatcttcgcaggtgtcgacgtgacc
aaggagcctattccggtcttgcccactgtccactacaacatgggtggtatccctacgcgc
tggaccggcgaggctttgacgattgatgaggagactggcgaggacaaggtcatccccggc
ctgctagcatgcggcgaggctgcgtgtgtgtctgtgcacggtgccaaccgtctgggcgcg
aactcgctgctggatctggtggtgttcggccgtgcggtggcgcacaccgtcgctgactcg
ctgcagcccggcttgccccacaagcctctgccagcagacctcggaaaggagtccattgct
aacctggagcgcatgcgtacagcctctggcccattgaccaccagccagatccgcttgaac
atgcagaaggccatgcagaaggacgtctctgtcttccgcacgcagcagaccctggacgag
ggtgtgcacaatgtgtctgctatcgacgagaccctgaaggacgtcggaacctcggaccgc
tccatgatctggaacagtgacctggtcgagaccctagagctgcagaacctattgacgtgc
gctgtgcagaccgccaagtctgccgctgagagaaaagagtcacgtggtgctcacgcgcgt
gaagacttcccagagagaaacgatgaggaatggatgaagcacacgctatcctggcaacat
gcatccggtgctcccgtcgagataaagtacagaaacgtcatcactacgacgctcgatgag
accgagtgcccaccagtgcctccaaccgtacgtgcttactga

DBGET integrated database retrieval system