KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL265WHelp
Entry
AGOS_ADL265W      CDS       T00167                                 

Definition
(RefSeq) ADL265Wp
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ago03036]
    AGOS_ADL265W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AGOS_ADL265W
Chromosome and associated proteins [BR:ago03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AGOS_ADL265W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl CDV3
Motif
Other DBs
NCBI-GeneID: 4619966
NCBI-ProteinID: NP_983831
UniProt: Q75B42
LinkDB All DBs
Position
IV:238360..240408
Genome map
AA seq 682 aa AA seqDB search
MAQPEPLQQFERQFEEFVKNNPNVLSAARSASRIPESAKAVIILSPLSLQHQFPRYWVSK
SYKKSIVERPERLLASSLGIAAAITMYPALFTLKSSHHRQTSLLSPHVLRVHGNDWPKAI
LRLCKQSDDRIQKRQLEVPDEWNVGDIYLCRGTIDALQGSIGALESGVDSIFDGPSAAST
PNRAFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRYGVTHAAILDFDLHHGDGTQD
ICWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDAS
VCIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYKG
LIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYSDA
ALVSGVFSHLIGMQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTKRSRDVIRNWAEEVIK
LGRSMIPEFQETFFADTATAEPPAARMTRSKHNEIIAKVDDSALALRSDTPSPPERKPLG
ATKATPHVRYASGTVQPLHTDSEDDDKDDYVYDEALNRTFNRTVEDITVDDISKHLETLE
IIQEPVPSRQHQLVLDPEPQHDPAASANASSKYRVPQLEATQRARRMKSSKPPNIEDSDI
SMISHFSAADKRRTTQGSRNKW
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaccggaaccgctgcagcagttcgagcgccagttcgaggaatttgtcaagaat
aacccgaatgtgctgtcggcggctagatctgcgtcgcgcatccccgagtctgcgaaggca
gtaattatcctttcgccgctatccctgcagcaccaattccccaggtactgggtctcgaaa
agctacaagaagtccatagtggagcggcccgaacggctgctggcgtcatcgctggggatt
gccgccgcgatcacgatgtatcccgcgctgttcacactcaagtcttcgcaccaccgccag
acttccctgctctcacctcatgtactccgagtgcatggcaatgactggccgaaagctatc
ctccgcttatgcaaacaatcagatgatagaatccagaaacggcagctggaagttccagac
gagtggaacgtgggcgatatatacctctgtcgtgggacgatagacgctctgcaggggtcg
ataggcgcgcttgagtccggcgttgactcaatctttgacggtccatccgccgcctcgact
cccaaccgggcatttgtggcattgcgtccccctgggcatcactcacatacttccacgcca
tctgggttttgtctgttgaacaacgcacacattgcggtggagtacgctgcctctaggtac
ggtgttacgcacgccgccatccttgacttcgacttgcaccatggagatggcacacaggat
atatgctggaaacgtgcaggcttcaagcccgacgatgaggaggataacgcggcggaatac
gacgactttggaaaaaggtttgctgagttccccaaggttggatatttctccctgcacgac
atcaattctttccccacagagcaaggttatgcacacaagacgagtatcaaagatgcctct
gtctgcatcatggattcgcacgatgttaatatctggaatattcatctaaccgcgtatgag
actgaggaggaattcaacaagctctaccagaccaagtatagggccatcttcgccaaggca
gacgaattcttaagagttagccaaaagcgcatggcttcagagggaaagaactacaagggc
ctcataattatcagcgccgggttcgacgcctccgaacacgagcagctgtccatgcagcgc
catggtgtccatgttccaacctctttttactgtgcttttacgaaagacgcgctaaaactc
gctcagatgcacacccagggcaaactcttgtcactactggaaggcgggtactccgacgct
gcgctcgtctctggcgtgttctcccacttgattggcatgcagaatcagaattggatacca
gagtggggctcagcacaggtaataaaggaagtttgcaggggttgtaggcccaattggaag
gcgtacaagaccaagcgctcgcgcgacgttatccgcaactgggcagaggaagtcatcaaa
ctcggcaggagcatgataccggagttccaggagaccttctttgcagacaccgcaacagca
gaaccgcccgcggcgcggatgactcgatcgaaacacaacgaaataatcgctaaggtggat
gactcggccctcgcgctgcgctccgataccccgtcgcctcctgaaagaaagcctctgggg
gccaccaaagccacgccgcatgtcagatacgcgtcgggcactgtgcagcctctccacacg
gactcagaggacgacgacaaggatgactacgtctacgacgaggccttgaacaggaccttc
aacaggaccgtcgaggacatcacagtcgatgacatttcaaagcacctcgaaaccctggag
ataatccaggagccggtgccgtctcgccaacaccaactcgtcctggaccccgaaccacag
catgatccggctgccagcgccaacgccagctccaagtaccgcgtcccgcagctagaagct
acacagcgggcgaggcgcatgaagtcatccaagccccccaacattgaagacagcgatatt
tccatgatatcccatttctccgcggccgacaagcgccgtactactcagggcagccgcaat
aagtggtga

DBGET integrated database retrieval system