KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADR253W
Entry
AGOS_ADR253W      CDS       T00167                                 

Definition
(RefSeq) ADR253Wp
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ago00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    AGOS_ADR253W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ago01001]
    AGOS_ADR253W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AGOS_ADR253W
Protein kinases [BR:ago01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   AGOS_ADR253W
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase RICTOR_M
Other DBs
NCBI-GeneID: 4620511
NCBI-ProteinID: NP_984349
UniProt: Q759M3
LinkDB
Position
IV:1142332..1143474
AA seq 380 aa
MDINHITNPTVTKQVYKGHGAPGAEEVVEITYPATEVVGHGSFGVVFTTVIEQTGEKVAI
KKVLQDRRFKNRELEIMKLLQHPNVVDLRYHFYESEPQTNEVYLNLILEYMPQSLYQRLR
HFVTGRLLMPRDEIKVYMFQLFKSLNYLHRVARVCHRDIKPQNLLVDAGTLQLKLCDFGS
AKQLRPTEPNVSYICSRYYRAPELIFGATNYTTQIDIWSTGCVMAELLLGQPMFPGESGI
DQLVEIIKILGTPTRQEICAMNENYSDHKFPQIKPIPLSKVFKREDAHTVQLLSDVLQYD
PTRRFNALMAMCSSYFDEITGHNTEPETVAPGASISELWQGVVHSLQLLHFKPEEFNDLN
DLERSLIQNKLIAKQPPNVP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggacatcaaccatatcaccaatccgacggtgaccaagcaggtgtacaagggccacggg
gcccccggggcggaggaggtggtggagatcacgtacccggcgacagaggtagtggggcac
gggtcgttcggcgtcgtgttcacgacggtgatcgagcagacgggagagaaggtggcgatc
aagaaggtgctgcaggaccggcgattcaagaaccgggagctcgagatcatgaagctgctg
caacacccgaacgtggtggatctgcggtaccacttctacgagagcgagccgcagacgaac
gaggtatacctcaacctgattctggagtacatgccgcagtcgctgtaccagcgattgcgg
cacttcgtgacggggcggctcctgatgccgcgcgacgaaatcaaggtgtacatgtttcag
ctgttcaagtcgctgaactacctgcaccgcgtggcgcgcgtgtgccaccgggacatcaag
ccgcagaacctgctggttgacgcgggcacgctgcagctgaagctgtgcgacttcgggtct
gcgaagcagctgcggccgacggagcccaacgtgtcgtacatatgctcgcggtactaccgc
gcgccggagctgatcttcggcgcgacgaactacacgacgcagatcgacatatggtccacc
ggctgcgtgatggccgagctgttgcttggacagcccatgttcccgggcgagtcgggcatc
gaccagctagtggaaatcatcaagatcctgggcaccccgacgcggcaagagatatgcgcc
atgaacgaaaactactccgaccacaagttcccccagatcaagcccattccgttgagcaag
gtgttcaagcgtgaggacgcacacacggtgcagctcctcagtgacgtgctgcagtacgac
cccacgaggcgcttcaacgcgctcatggcgatgtgcagctcctacttcgatgagatcacc
ggccacaacaccgagcctgagaccgttgccccgggcgcgtcgatctcagagctgtggcag
ggcgtagtgcacagtctacagctgctgcacttcaaacccgaggagtttaacgacctgaat
gacttggaacgatccctaatccaaaacaaattgattgctaagcaacctccgaatgtaccc
tag

DBGET integrated database retrieval system