KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER061CHelp
Entry
AGOS_AER061C      CDS       T00167                                 

Definition
(RefSeq) AER061Cp
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00020  Citrate cycle (TCA cycle)
ago00480  Glutathione metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
ago01210  2-Oxocarboxylic acid metabolism
ago01230  Biosynthesis of amino acids
ago04146  Peroxisome
Module
ago_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ago_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGOS_AER061C
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGOS_AER061C
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AGOS_AER061C
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AGOS_AER061C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4621124
NCBI-ProteinID: NP_984921
UniProt: Q757F2
LinkDB All DBs
Position
V:complement(748897..750174)
Genome map
AA seq 425 aa AA seqDB search
MLGRGRMLGRRLFSGSRAAARIRVKTPVVELDGDEMTRIIWERIKQQLVLPHVDVELKYY
DLSITSRDATSDQVTVDAAHAIKQYGVGVKCATITPDEARVREFGLKKMWRSPNGTIRNI
LGGTVFREPIVIPRIPRLVPGWEKPIIIGRHAHGDQYKATDAVVPGAGTLDLVFRPADGS
APTSLHVYDFAGPGVALAMYNTEESIRGFAHASFRLALAKQLNLFLSTKNTILKQYDGRF
KDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGGFIMALKNYDGDVQSDIVAQ
GFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRQHQAGKETSTNSIASIFAWTRGLAKR
GELDNTPDVVNFAHALEAATTNTVQLDGIMTKDLALACGRSDRSAYVNTNEFIDAVEARL
KKELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcagaggcaggatgctcggcagaaggttgttttcaggtagcagggcggcggcg
cggatccgggtgaagacgccggtggtggagttggacggggatgagatgacgcggatcatc
tgggagcgcatcaagcagcagctggtgctgccgcacgtggacgtggagctgaagtactac
gacctgtcgatcacgtcgcgggacgcgacgtcggaccaggtgacggtggacgcggcccac
gcgatcaagcagtacggggtgggcgtgaagtgcgcgacgatcacgcccgatgaggcgcgc
gtgcgggagttcgggctgaagaagatgtggcggtcgcccaacggcacgatccgcaacatt
ctgggcgggacggtgttccgcgagccgattgtgattccacggatccccaggctggtgccg
gggtgggaaaagccgatcatcatcggcaggcacgcgcacggggaccagtacaaggccacg
gacgcggtggtccctggcgcgggcacgctcgacctggtgttccggccggcggacggatct
gcacccacttcgctgcatgtgtacgacttcgcggggcctggcgttgccctggcgatgtac
aacaccgaggagtccatacgcggcttcgcgcacgcgtcgttccgcctggcgctggccaag
cagctgaacctgttcctgtcgacgaagaacacgatcctcaagcagtacgacggccgcttc
aaggacgtgttcgaggagctgtaccaggcgcagtacaaggccgagttcgagcgcctgggc
atctactacgagcaccgcctcatcgacgacatggttgcgcagatggtcaagtccaagggc
ggcttcatcatggcactcaagaactacgacggcgacgtccagtcggacatcgttgcgcag
ggcttcggctcgctcggcctgatgacctcggtcctggtgacgccggacggcaagaccttc
gagagcgaggctgcccacggcaccgtcacgcgccacttccgccagcaccaggcgggtaag
gagacgtccaccaactccatcgcgtccatctttgcctggacccgcggcctcgccaagcgc
ggggagctcgacaacacgccggacgtggtcaacttcgcccacgcgctcgaggcggccacc
acgaacacggtccagctcgacgggatcatgaccaaggacctcgcgctggcctgcggcagg
tcggaccgctcggcctacgtgaacacgaacgagttcatcgatgccgtcgaggcacggctc
aagaaggagcttgcttag

DBGET integrated database retrieval system