KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER140CHelp
Entry
AGOS_AER140C      CDS       T00167                                 

Definition
(RefSeq) AER140Cp
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 4621205
NCBI-ProteinID: NP_984999
UniProt: Q756W1
LinkDB All DBs
Position
V:complement(900284..901528)
Genome map
AA seq 414 aa AA seqDB search
MNELSDQLSQNLKCDITLIGQRVMRAPQLIKDKLDIGFQFKDKSFDVIQETFNHIHNSVL
TLDTECTRFSTQITNLMNHTQNLNRGFQEIISRGAWDNIQVGSPVSPNSVMSPVGRDFSP
AVATPTTKRFNFSKYVDRFQTTIVKIKSDQQQFQTRVVLPLLQLKDLGLRIQKPLEERRN
LVLDINSYSSKVEKYNQRVHTNELTLKGEQKRMKYDKKLEDVRFKYEALNSILKVELQVY
FDLFRDFLSAWFPLYLYITYSLYYNLYQFLGNCPEVRKLLEKSGFSSLAPVSSVVNTSRN
LVEDFHVSFDGAMKHLQSLNIINYKKLCALVYAGENDDGSRANAFSGIIPTVYATALYDY
DPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQVQDYGL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaattgtctgatcagctatcccaaaatctcaaatgtgacattacgctgattggc
cagcgagtcatgcgcgcgccgcagcttatcaaggataaactcgatattgggtttcaattc
aaagataaaagcttcgacgttatccaggagacatttaatcacatacataactccgtattg
acccttgatacggaatgcacgcggttttctacccaaattaccaacctcatgaatcatacg
cagaacttgaatcggggctttcaggagatcatctcccggggcgcttgggataatattcag
gtcggttcgccggtgtcgccaaacagtgtcatgtcgccagttgggagagacttttctcct
gctgtggcaacgccgaccacgaagcggtttaatttcagcaagtacgtggaccgattccaa
acgactatcgtgaagatcaagtctgatcagcagcagttccagacgcgcgtggtcttgccc
ctcctgcaactcaaggacttggggctgcgcatacagaaacccctagaggaacgccggaat
ctcgtgctcgacatcaattcgtacagcagcaaggttgagaagtacaatcagcgcgtccac
acgaacgagctcacgctcaaaggagagcaaaaacgcatgaagtacgacaagaagcttgag
gatgttcgcttcaaatacgaggcgttaaactccatcctcaaggtcgagcttcaagtgtac
tttgacctattccgcgacttcttgagcgcctggtttcctctttacctctacatcacttac
tcgctttattataacctctatcagttcttgggcaactgcccagaagtccggaaactactt
gagaaaagcggcttttctagtctggcccctgtatcgtctgtcgtcaacacgtcgcgcaac
cttgttgaggatttccatgtttcgttcgatggcgccatgaaacacctccagagcctcaac
atcatcaactacaagaagttgtgcgcccttgtatatgcaggcgaaaatgatgatggctcc
agggccaacgcgttttcgggaatcatccctaccgtgtacgccaccgcgctttacgattac
gatccccagttcaacgacccccagtacctttccattaagaagggggacatcatccaggtg
attacgcaatcaaaaaatggatggtggtatggcgatcttcttcgtaccaaaactaagggt
ctattccctcagagttacgtgcaggtccaagactatgggctgtga

DBGET integrated database retrieval system