KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER374CHelp
Entry
AGOS_AER374C      CDS       T00167                                 

Definition
(RefSeq) AER374Cp
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00020  Citrate cycle (TCA cycle)
ago00310  Lysine degradation
ago00380  Tryptophan metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
Module
ago_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ago_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGOS_AER374C
  09105 Amino acid metabolism
   00310 Lysine degradation
    AGOS_AER374C
   00380 Tryptophan metabolism
    AGOS_AER374C
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AGOS_AER374C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 4621446
NCBI-ProteinID: NP_985230
UniProt: Q755Z3
LinkDB All DBs
Position
V:complement(1327711..1330725)
Genome map
AA seq 1004 aa AA seqDB search
MLRAMGVTRRALWQRSAGLAARAARPYASGPAGDTFLSSTNAAYIDEMYAAWQQDPASVH
VSWDAYFRNMKNPSIAAGAAFVAPPTLVPTATDPGVPQHMPSVLGEDSDVLVHLKVQLLC
RAYQVRGHQKAHIDPLGIAFGDDKSRSVPRELTLEHYNFSEKDLEREITLGPGILPRFAR
DGRRTMKLGEIVAALEKLYCSSYGVEYIHIPSREQCEWLRERIEIPKPYDYSAEEKKQIF
DRLTWATSFESFLSSKFPNDKRFGLEGLEAVVPGIKTLIDRSVDLGIEDVVLGMAHRGRL
NVLSNVVRKPNESIFSEFQGSHTPSDYEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPS
HLEAENPVVLGRVRAIQHSKNDVGTFKKAMGVLLHGDAAFAAQGVVYETMGFLHLPAYST
GGTIHVITNNQIGFTTDPRFARSTSYPSDIGKTIDAPIFHVNANDIEAVNFIFNLAAEWR
ATFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYKQIAKQPSVIDVYTKKLLDEGSMTNEQ
IDTHKKWVWGLFEEAFSKAKEYKPSSREWLTAAWENFKSPKELATEILPHNPTNVDASTL
KQIGSVLSSWPTDFEVHRNLKRILLNRGKSIESGEGIDWSTGEALAFGTMLMEGTHIRVS
GEDVERGTFSQRHAVLHDQNSENTYTPLKHVSKDQADFTICNSSLSEYGCIGFDYGYSLT
SPDYFVMWEAQFGDFANTAQVIIDQFIAGAETKWKQRSGLVLSLPHGYDGQGPEHSSGRL
ERFLQLTNEDPRYFPSEEKIQREHQDCNFQVAYPTTPANLFHILRRQQHRQFRKPLVLFF
SKQLLRHPLARSSLSEFTDGGFQWIIEDIEHGKAIVSKEETKRLVILTGQVYTALHKKRE
ALGDRTTAFLRIEQLHPFPYAQLRDALNSYPNLEDIVWCQEEPFNMGSWAYVQPRIQTTL
KETDKYSGFAFRYAGRNPSGAVAAGSKALHTTEEEAFLKDVFGQ
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagctatgggggtgacacggcgggcgctgtggcagcgcagcgcggggctggcg
gcgcgggcggcgcggccgtacgcaagtgggccagcgggtgacacgtttctgtcgtcaacc
aatgcggcatacattgacgagatgtacgcggcgtggcagcaggacccggcttctgtgcac
gtgtcgtgggacgcgtactttcgcaacatgaagaacccttcgattgccgctggggcagct
tttgtggcaccacccacgcttgtgcctaccgccactgatcctggcgtgccgcagcacatg
ccgagcgtgcttggcgaggacagcgatgtgctcgtgcacttgaaggtgcagctactatgt
cgtgcgtatcaggttcgggggcaccagaaagcacacattgacccgctcgggatcgcattt
ggcgatgacaagagccgctcggttccaagggagctcacgctagagcactacaacttctct
gagaaggaccttgagcgcgagatcaccctgggcccgggtatcttgccacgctttgcaagg
gatggcaggcgcacgatgaagctgggtgagattgttgccgcgttggaaaagctttactgc
tccagctacggtgtcgaatacattcacattccatcgcgcgagcagtgcgaatggttgcgt
gagcgaatcgagatccccaagccatacgactattccgcggaggagaagaaacagatattt
gacagattgacgtgggcgacatcgtttgagagcttcctgtcttccaagttccctaacgac
aagcgtttcgggcttgaaggtctagaggctgtcgttcctggtatcaagacgttgattgac
cgctcagtggacctgggtattgaggatgttgtccttggtatggctcaccgtggtcgtttg
aacgttctgtccaacgtggtgcgtaagccaaacgagtctatcttctcggagttccagggt
tcgcacacgccatcggactacgagggctcaggtgatgtgaagtaccacctggggatgaac
taccagagacctaccacctctggtaaatatgttaatctatcgttagttgcaaacccgtcg
catctggaggctgaaaacccagtggttctaggaagagtccgtgccatccagcattctaaa
aacgatgttggcacgttcaaaaaggccatgggtgttttgctgcacggtgacgcagccttt
gctgcacagggtgtcgtttatgaaactatgggattcttgcatctgcctgcatactccacc
ggtggtactatccacgtgatcacgaacaaccagattggcttcacaactgaccctaggttt
gctagatccacctcgtatccatcggatatcggaaagaccattgacgccccaattttccat
gttaatgcgaatgacattgaggcagtgaatttcattttcaacctagccgccgaatggagg
gctaccttccacaccgacgccatcattgatgttgttggatggagaaagcacggtcacaat
gaaaccgaccagccgtccttcactcagccgttgatgtacaagcaaattgctaagcagcca
tctgtgatcgatgtatacactaagaagctattggacgaagggtcgatgaccaacgaacag
attgacacccacaagaaatgggtttggggcttgtttgaagaggccttctcgaaggccaag
gagtacaagccttcctccagggagtggttaaccgccgcatgggaaaacttcaagtcgcca
aaagagttggcgaccgaaatcttgcctcataacccaacgaatgtcgacgcatcaactttg
aagcagatcggttctgttctatccagctggccaacagactttgaggtccacaggaacttg
aagagaatcctactgaaccgtggtaagtccattgaatcgggtgagggcattgattggtct
acaggtgaggctttggcctttggtacgatgttgatggagggcacacacatcagagtgtct
ggtgaggatgtggagagaggtacattctctcagagacacgctgtcttgcacgaccagaac
tcggaaaacacatataccccgctaaagcacgtttctaaagatcaggcggactttaccatc
tgcaactcttccctttccgagtatgggtgtataggtttcgattacggttactcgttgaca
tccccagattacttcgtgatgtgggaagctcaatttggtgactttgccaacaccgcgcag
gttatcattgatcagttcattgcaggtgctgaaacgaaatggaagcaaagatcgggcctc
gtgttgtcgttgccacacggttatgatggccaaggacccgagcattccagcggtcgtctg
gaaagattcttacaattgaccaatgaggacccaaggtacttcccaagcgaagaaaagatc
cagagggaacaccaggactgcaacttccaggtcgcttatccaacaacccctgcgaactta
ttccatatcttgagaaggcaacagcaccgccaattccgcaagccattggtcttattcttc
tccaagcagctgctgcgtcatccacttgccagatcgagcctatcagagttcactgacggt
ggtttccaatggattatcgaagatatcgaacatggcaaggccattgtctccaaggaggag
accaagaggcttgtcatcttgactggccaggtttacacagcactccacaagaagcgtgaa
gccctgggcgacaggacgacagcattcctacgtattgagcagctgcatccgttcccatac
gcccagttacgggacgccttgaactcttatccaaacttggaggatattgtttggtgccag
gaagagcctttcaacatgggctcttgggcatacgtccagcctcggatccagacgactttg
aaggagactgacaagtacagtggctttgctttccgctacgccggtagaaaccctagcggt
gccgtggccgccggttccaaggccttgcacactaccgaggaagaggccttcttgaaagat
gttttcggccaatga

DBGET integrated database retrieval system