KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR133CHelp
Entry
AGOS_AFR133C      CDS       T00167                                 

Definition
(RefSeq) AFR133Cp
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ago00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AGOS_AFR133C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ago03400]
    AGOS_AFR133C
DNA repair and recombination proteins [BR:ago03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     AGOS_AFR133C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc XPG_I_2 PDEase_I
Motif
Other DBs
NCBI-GeneID: 4621930
NCBI-ProteinID: NP_985680
UniProt: Q754D7
LinkDB All DBs
Position
VI:complement(676677..679589)
Genome map
AA seq 970 aa AA seqDB search
MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQFLKAARDKNGNRLKGAHIIGFFR
RICKLLYFGIKPVFVFDGGVPPLKRETIRQRKERREGKRESAAVTARKLLALQVQQQGDT
AFKGNSRSKSEGSVTFRPSDEYELPNIPGFLYDERDERVMSTEEYKAVFEHLDELDGIDL
ESINPASKEFDELPNATQYLILSTLRLRSRLRMGYTKEQLEEIFKDSMDFSRFQIEMVKK
RNFYTQKLMNTTGVHDGGLSKLDLEHSRSRVAGQRQKEYTLVKTEMGWAMSLGEYDGSEA
SKAIPLDDAAIAPTRPVQSSWSGNDVEDSDEDNLEWEDIDIAPKKEKKVADYSLKASAIP
TTIVEGSSTGSQSFLDRPFRNSGKLRQPERAIQFVDDNSTDSDREYLDYVEETTNMEELK
KTRGNLAGVEHRVSKHNPYKTAPDNATSEESLKDLSEVEEVPRKPGTRNDAQFPLQHKGT
HNIMTDKINSELNDRMIPDVHTLPSINLGKGSFLFDIKTSKEESSSSGETKPEQRKINQD
VPLWFNSVPTTNPHTATGFVSDKETSTFTEDEKLGIFSGVAATELMRQNVSSTDLESLEK
ELDGDSNDLEELTQLNKEHTEPTRAPDIPKGYLLKDTTQRSKEESTFAYDFPEEEEEVLV
EQLRKEHADYNRFKHTLDPSIATTAFIEDELYEQNTKDKRDADEVTPEMIRDIQQLLSIF
GIPYLTAPMEAEAQCAELLRLKLIDGIITDDSDVFLFGGSKVFKNMFQEKNYVEYYNTET
ISAELGLDRLKFIALAQLMGSDYTNGIKGIGPVSGIEILANYNTLEEFRTWYNEGQFRKS
LLDKESLFQKNLRKKLTKSGVVLGDDFPSAAVSDAYLNPEVDHDTTKFVWGLPELDSLRT
FLGSTLGWPTEKADEVLIPLIRELNKRRSKGTQSTLVEFFPTKFIDADKGAKLGRRIRDA
TVMLKKRRTK
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgcatgcactatgggatattttgggaccaactgcacgccctgtcaaactcgag
tctctatccaacaatcgcatggctgtcgatgcatccatatggatatatcagttcttgaag
gcagctagggacaagaatggcaataggctgaaaggcgcccatataattgggtttttccgt
cgcatatgcaagttattatactttggcattaaacctgtgttcgtttttgatggtggtgtt
ccacctttgaagagggaaactatccgtcagaggaaggagaggcgagagggcaagcgcgag
agtgcagcggtaactgcccgcaagctgctggccctacaggtacagcaacagggggacacg
gcatttaagggcaatagtaggtcaaaatctgaaggttcggttaccttccgcccatctgat
gagtatgaactaccgaatattcctggcttcctatatgatgagcgcgatgaacgtgtaatg
tcaaccgaagagtataaggctgtgtttgaacatctagacgaactagatggtattgattta
gagtcaattaaccctgcatccaaagaatttgacgaacttccaaatgcgacccaatacctt
attctctccactctccgcctacgttcgagattaagaatgggttacaccaaagaacaactt
gaggaaatattcaaagatagcatggatttctcacgattccaaattgaaatggttaaaaag
aggaatttttatactcaaaagctgatgaatacaacgggcgtccatgacggtggcctttcg
aagttggacttggaacattcacgcagcagagttgcaggccagcgacagaaggagtataca
cttgttaaaacagagatgggctgggcgatgagtcttggagagtatgatggatcagaggct
agcaaagctattcctctagatgacgctgctatagcgcccacgcgtccagtgcagtccagt
tggtctggaaacgatgtcgaggacagtgatgaggataatctcgaatgggaggatatcgat
atagcgcctaagaaagaaaagaaggtagccgattactcgttgaaggcttctgctattccc
acaacaatagtagagggaagttctactggcagtcagtcttttctggatagaccttttaga
aacagtgggaaattgcggcaacccgagagagcgatacagtttgttgacgacaatagtacc
gattcagatcgtgagtatttggattacgtagaagaaacgacgaatatggaggaactaaag
aaaacccgtggcaacttggcaggcgttgagcatcgcgtctcgaagcataatccttacaaa
acagctccagataatgccactagcgaagaatcattaaaagacttatcagaagtagaagaa
gtccctcgaaagcccggtactcgcaatgatgcacagtttcctttgcagcataaaggtact
cataatattatgacagataaaataaattcggaattaaatgaccgcatgatacctgacgtg
cataccttgcccagcattaacctaggtaagggctcattcctatttgatattaagacctct
aaagaagaatcatctagctctggtgaaacaaaacctgagcaacgtaagattaatcaggat
gtacccctttggtttaattcagtgccaacaaccaatcctcacacagctactgggttcgtt
tcagataaagagacaagtactttcactgaggatgaaaagcttggtatcttctcgggggtt
gctgccacggaactcatgcgtcagaatgtgtcctctaccgaccttgaatcgctggaaaag
gaactggatggtgattctaacgacctggaagaacttacgcaactaaataaagaacacaca
gagccaacgcgtgcacctgacataccaaaaggatatttgcttaaggataccacacaacgc
tcaaaagaagaatctactttcgcatatgacttccccgaagaagaggaagaagtcctagtc
gagcagttaaggaaagaacatgccgactataatcgcttcaagcacacgttagacccttcc
attgcgactaccgcatttattgaagacgaattatatgaacagaatacgaaggataagcgt
gacgctgatgaggttacgccagagatgattagggatattcaacagctgctgtctatattc
ggcatcccttacctaaccgcgcctatggaagcagaagctcaatgtgcagagcttttacgg
ctgaagctgatagacggtatcattacagatgatagtgatgttttcctgtttggagggtca
aaagtctttaaaaatatgttccaagaaaagaactatgttgagtactacaatacggagact
atatcggcagaactaggcttagaccgtttaaagttcatcgcgcttgcccaattaatgggt
agtgattatacgaatggcatcaaaggaattggaccggtgtccggtatagagatacttgct
aattataacactctggaagagtttcgcacatggtacaatgagggacaattccggaaaagc
ttgctagataaggagtcgctattccaaaagaatctccgaaaaaagctgactaaaagtggt
gttgttctgggcgacgatttccctagtgcggcggtaagtgatgcgtaccttaacccagag
gtggaccacgatacgaccaaatttgtgtggggcctaccagaattggacagtctgagaact
tttcttggtagcaccctcgggtggccgacggaaaaagcagacgaggttctgattccgctt
atcagagaactgaacaagcggagaagcaagggtacacagtctacattagtcgagttcttt
cccacaaaatttattgacgctgacaaaggcgcgaaattaggtagaagaattagagatgcc
acggttatgctcaagaaacggcgtacgaagtaa

DBGET integrated database retrieval system