KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR279CHelp
Entry
AGOS_AFR279C      CDS       T00167                                 

Definition
(RefSeq) AFR279Cp
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00010  Glycolysis / Gluconeogenesis
ago00051  Fructose and mannose metabolism
ago00052  Galactose metabolism
ago00500  Starch and sucrose metabolism
ago00520  Amino sugar and nucleotide sugar metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
Module
ago_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ago_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_AFR279C
   00051 Fructose and mannose metabolism
    AGOS_AFR279C
   00052 Galactose metabolism
    AGOS_AFR279C
   00500 Starch and sucrose metabolism
    AGOS_AFR279C
   00520 Amino sugar and nucleotide sugar metabolism
    AGOS_AFR279C
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AGOS_AFR279C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ago04131]
    AGOS_AFR279C
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AGOS_AFR279C
Membrane trafficking [BR:ago04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AGOS_AFR279C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 4622089
NCBI-ProteinID: NP_985826
UniProt: Q753N3
LinkDB All DBs
Position
VI:complement(937749..939215)
Genome map
AA seq 488 aa AA seqDB search
MVHLGPKKPPTRKGSMADVPKTLVEQIASFERIFTVSAEKLQEITKHFVTELDKGLSKKG
GNIPMIPGWVMDYPTGNETGDYLAIDLGGTNLRVVLVKLLGNHQFDTTQSKYRLPNRMRT
TQNASELWDFIAESLKDFLEEQFPEGVHQTLPLGFTFSYPASQDKINMGILQRWTKGFDI
PGVEGHDVVPMLQESLRKVNVPIEVVALINDTTGTLVASLYTDAETKMGVIFGTGVNGAY
YDVVKDIEKLEGRLPEDIPPESAMAINCEYGSFDNEHLVLPRTKYDILIDEQSPRPGQQA
FEKMTSGYYLGEVLRLALLDLHGQGLIFQGQDISKLETPYVMDTSFPARIEDDPFENLEE
TDDLFKDNLDIDTTRPERKLIRKLSEMIGNRAARLSVCGIAAICQKRGYETAHIAADGSV
FNKYPGFQTRAAEGLRDIYGWEHSSSQDYPIKIVAAEDGSGAGAAVIAALTTKRLAAGKS
VGLPEAQN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggtccaaagaagcctcctacgagaaaggggtccatggcggacgtgcca
aagacgttggtggagcaaattgccagtttcgagcgcatcttcaccgtctcggctgagaag
ctacaggaaattacaaagcactttgtcaccgagttggacaagggtctgtccaagaaaggg
ggcaacatcccaatgattcccgggtgggtgatggactaccctaccggtaacgagaccggt
gactacttggccattgacttggggggaacgaacttgagagttgttctagtcaagttgctt
ggcaaccaccagttcgacaccacgcagtccaagtacagattgcctaaccgcatgagaacc
acccagaatgcgagcgagttgtgggacttcattgccgagagtctaaaggacttcttggag
gagcagttcccagaaggcgttcaccagacgctacctttgggctttaccttctcttaccct
gcatcccaggacaagatcaacatgggtatcttgcagagatggaccaagggctttgacatc
ccaggcgttgagggccacgacgtggtcccaatgttgcaggagtcgttgaggaaggtgaat
gttccaattgaggttgttgctttgattaacgacaccaccggtaccttggttgcctccttg
tacaccgacgcggagactaagatgggtgtgattttcggcaccggtgtcaatggtgcttac
tacgatgttgtcaaggacattgagaagttggagggccgcttgccagaagacatcccaccg
gagtctgccatggccatcaactgtgagtacggctctttcgacaatgaacatttggttctt
ccaagaaccaagtacgacattctaatcgatgagcagtctccaagacctggccagcaggct
ttcgagaaaatgacctctggttactacttgggtgaggtgcttcgtttggctctcttggac
ctacacggccagggcttgatcttccaaggccaagatatctctaagttggagaccccatac
gtgatggacacttctttccctgctagaattgaggatgatccatttgagaacttggaggaa
accgatgacttgttcaaggacaacttggacattgacactacccgtccagagcgtaaattg
atcagaaagttgtccgagatgattggtaacagagctgcaagactatctgtgtgtggtatc
gctgcaatttgccagaagagaggctacgaaaccgcacacattgctgcagatggctctgtc
ttcaacaagtacccaggtttccaaactagagctgccgagggcttgagagacatctacggc
tgggagcactcttcttcccaggattacccaatcaagattgtcgctgctgaggatggttct
ggcgctggtgccgcggtcattgcagctttgaccacgaagagattggcagcaggcaaatct
gtcggcttgcctgaggcgcaaaattaa

DBGET integrated database retrieval system