KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL185WHelp
Entry
AGOS_AGL185W      CDS       T00167                                 

Definition
(RefSeq) AGL185Wp
  KO
K12158  ubiquitin-like protein Nedd8
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ago04121]
    AGOS_AGL185W
Ubiquitin system [BR:ago04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AGOS_AGL185W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2 TUG-UBL1
Motif
Other DBs
NCBI-GeneID: 4622775
NCBI-ProteinID: NP_986482
UniProt: Q750X4
LinkDB All DBs
Position
VII:join(352585..352733,352782..352863)
Genome map
AA seq 76 aa AA seqDB search
MLLKVKTLTGKEIQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGKQIDDDQTVMSAR
LAHGMQLHLVLTLRGG
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgttactgaaggtcaagacactaacgggcaaggagatccagatcgacgtggcgcccgag
gacaaggtctaccgcatcaaagagctgctggaggagcaggagggcatcccgccctcccag
cagcgcctgattttccaaggtaaacagatcgacgacgatcagacggtgatgtccgcgcgg
ctggcgcacggcatgcagctgcatctggtcctgacactgcgcgggggttag

DBGET integrated database retrieval system