KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL186CHelp
Entry
AGOS_AGL186C      CDS       T00167                                 

Definition
(RefSeq) AGL186Cp
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ago03012]
    AGOS_AGL186C
Enzymes [BR:ago01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     AGOS_AGL186C
Translation factors [BR:ago03012]
 Eukaryotic type
  Release factors
   AGOS_AGL186C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_11 Methyltransf_31 PrmA Methyltransf_18 Methyltransf_33
Motif
Other DBs
NCBI-GeneID: 4622774
NCBI-ProteinID: NP_986481
UniProt: Q750X5
LinkDB All DBs
Position
VII:complement(351824..352483)
Genome map
AA seq 219 aa AA seqDB search
MLATPEVKCDPERVYEPSEDSFLLLDCLEKERTWLRQRQPRASVVCEVGCGSGVVTAFMM
QHEMPQPMSVYLATDVSPWALATTAETVQSTGCRGALCAARTDLVTGLADGQVDVLVFNP
PYVPAEGVPQGPAAGEREERWLEVALEGGADGMEVTTRMLGALGRVLASSGVAYILFCAR
NRPEEVAAGMRAAGWVAELVERRRAGWEVLSVYRFYRNS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgactccggaagttaagtgtgatcctgagagggtgtacgagccgagcgaggac
tcgtttttgctgctggattgcctggagaaggagcggacgtggctgcggcagcgacagcca
agggcttcggtggtgtgcgaggtgggctgtgggtcgggggtggtgacggcgttcatgatg
cagcacgagatgccgcagccgatgagcgtgtacttggcgacggacgtgagcccatgggcg
ttggcgacgacggcggagacagtgcagagcaccgggtgccgcggggcgctgtgtgcggcg
aggacggatctggttacggggctagcggacgggcaggttgacgtgctggtgtttaacccg
ccgtacgtgccggcggagggagtgccgcaggggccggcggcgggcgagcgcgaggagcgc
tggctggaggtggcgctggagggcggcgcggacgggatggaggtgacgacacgcatgctg
ggcgcgctggggcgggtgctggcctcgagcggtgttgcgtacatcctgttctgcgcgcgg
aaccgcccggaggaggtggccgcggggatgcgggcggctggctgggtcgcggaactggtg
gagcggcggcgagcgggctgggaggtgctgagcgtttatagattctatagaaacagttag

DBGET integrated database retrieval system