KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL187WHelp
Entry
AGOS_AGL187W      CDS       T00167                                 

Definition
(RefSeq) AGL187Wp
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 4622773
NCBI-ProteinID: NP_986480
UniProt: Q750X6
LinkDB All DBs
Position
VII:346809..351827
Genome map
AA seq 1672 aa AA seqDB search
MSLPLKPLSIDSNFKRLDSKQSKYHQNVQKALQHFDAVTEWADYISSLGKLLKALQSWTP
QFQNVKYYVPFPYQVSRRLASSLSPDLPSGVHLKTLDVYIFIFEKIGMEALSKECNIWVA
GILPLMAYASISVKSPVIELYEKYLIRLPPSMLRLLAKPLIASLLPGVDDESSEFQPMVL
GLLDDLRRNLGDDSLFWQSCFMIMLSLRNRRLGGLVWMTKRLPSLNAVPHLVSQYQQQAA
EGNGDVQDKKQQRQAALALLLPESRCIVSPEPGLLIRSLVNSLREENELLIQRGILDLLA
QRIHLHSPVLQTLVTKADRELLIMSCCKTMLKKDMSLNRRIWNWLLGPSSRVQQADTPLN
DYFPKYGLESLMNGIIAMIGSESELPNAFKICLALMDRWEIGSRIVPHLFIKLMKAADKF
KESKHVITVASMFFDSIETTVIWGSCYEAITQKHDYDLLEFLLSTFNVATDEEIVVRHCP
LILLTMLLLSFEDEPAITKQKYRLCNALADIIPDKAYLPLSLSALVGEEGKSSVELLSAI
TNFYIAEANPLVPNSADKMPPFPPADLAFLITEKVYLLLLKSLETGCMVNEMSHLYVSLI
GKIPTQPDAEDKATEADQALVSQIFSLGQKLDEDNSKDSIFGIVVLYSDYLAHQVDLIDS
LKILKMIVDCLWHYLLDPNRQMEAIRCLLALNRGISKQHIEGALTSAFIREKDIAAKLTV
LDALWTKLENDIGMIRRPLQLMFDELFDEQHLSYLHVSKWIVSVINANASNRLFQVLADN
LLSFDFLMKETLTELDDLDLFTYHVQTVTNVLRTEQSVLLKSFSLELTSLHSFEQWREED
VSTYKGLTIGILLRFLNLENNTHGRSIRSALILLDTLIDGTEQNFKAIVTSLLQLSTKYI
KIKVPESELIIVSLLSIVSKILSLSHKNDIKLDIFDDNSSHINYIDFLVSSIANIESPLT
VSSYVQLLSESIIYFQHSIFNIILPLSSSLTQCIERLFYQSEDKGKNYKSFSLLIDGLEE
LLEVSHGYLMAGENNGYLNGPNSKNDFLQSMVSNVFSNDPSNSTSKLQGEREVVFQSYKR
AIDCSFGIWIWAQNISNSRALPPDHCVGDPEYSESAHQLSYKYKFKTKKLIDKLFTLEPL
EILENLISYRMDDLTITLTHVLDGNRPVLTLPHLMLSVVSKCNKATTVTFSSIASRKSSD
HLVTAAKLEPKQVLAFIIEYVRSLENAAIEDFYNDFLVFIKEVSQNYSQYEQLSYQLLIL
IAIISEKIAHSQFGQQKRVRKEVSDVFVKYLTSTLAEDIVAKNGVCEANYQDILFILARL
QYIVNESPQGDRFGACVSTIVSHCVSPLLKQGKLEVSSPGFMELLLAIAPVGAKVRNWKT
LLNDIFTDNTKLSMCLKEDRWNQVIYEWSQYPDNQDKLISDLLLAIGQKGNVITPTINPF
QGWAESEVDLKCKQMVKLAYLLLIAPPDTYLLYFKQLMSQLEDYLFSTDTPLKANCFILL
RAVFLCIEQMHIADYWSMISHGLQTGLQAFYESLQIQEPIDAHLVLHMCKCLDLLLVLNI
EDFSATNEWLFIIDTINCIYKTDPFMALIDEISECKDYTGSHIADIELAAGDARLPLLCG
IRRVDSHLALRTFFHNLSYSHYETSYSLKPIDQAACCRDVAADILAAISTTN
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgccgttgaagcctctgtcgatcgactcgaacttcaagagactagattccaag
caaagcaagtaccaccagaacgtgcagaaggcactacagcacttcgatgctgtgactgag
tgggcggactacatttcgagtctgggcaagctgctcaaggcgctgcagagctggacgccg
cagttccagaacgtgaaatactacgtgcccttcccataccaggtcagccgccggctggcg
tcgtcgttgtcgcccgacctaccgtccggtgtgcacttgaagacgttggacgtgtacata
ttcatatttgagaaaattgggatggaggcgctaagcaaggaatgcaatatttgggtggcc
ggtatcctcccgctcatggcgtatgcgtcgatctccgtcaaatcacccgtgatcgagctg
tacgagaagtacctgatacggctccccccgtcgatgttgcggctgctggcaaagccgctc
attgctagtctgctgcccggcgtcgacgacgagagcagcgagttccagcctatggtgctg
gggctgctggacgacctgcggcgcaacctgggggacgactcgctgttctggcagagctgc
ttcatgatcatgctgtcactgcggaaccggcggctgggcgggctcgtgtggatgaccaag
cggcttccctccctcaatgcagtgccacacctggtttctcagtaccaacagcaggcagca
gaggggaacggcgatgtgcaagacaagaagcagcagcgccaagccgctctggcgcttttg
ctgcccgagtcgcgatgtatagtctcgcccgagccgggtctgctgatccgttctctggtc
aacagtctgcgcgaagagaacgaactcttgatccaacgtgggatcctggatcttctggca
caacgcatccatctccactctcctgttctgcagacgctggtcacaaaggctgatagagag
ctgctgattatgagctgctgcaagacaatgttgaaaaaggacatgtcgttgaatcggcgc
atatggaactggctcctgggcccttcctcccgcgtacagcaggcggatacgcccctgaat
gactacttcccaaagtatggcttggaaagtttgatgaatggaatcattgccatgataggt
tcggagagcgaactccccaacgcctttaagatatgtcttgctttgatggatcggtgggag
attggctcgcgcattgtgccgcatctctttattaagctgatgaaagccgcagacaagttc
aaggagagcaagcatgtcataacggttgcctctatgtttttcgattccatagaaactact
gtaatttgggggagctgctacgaggcaataactcagaagcacgattatgatctattagag
tttttattgtctaccttcaatgtggcgacggacgaagaaattgtggtccgtcattgtcct
ctaatattgctcactatgctcttactttcctttgaagatgagccggcaatcaccaagcaa
aagtatcgactctgcaatgcactcgcggatattattccagacaaggcatacctcccccta
tctctttctgctttggtgggcgaggagggcaagagtagcgtggaattgttgtccgccatt
acaaacttttacattgctgaagccaatcctctggtgccgaactctgcagacaaaatgcca
ccgttcccccccgcggacttggctttcctgatcactgaaaaagtgtaccttttgcttttg
aagagtttggagactggatgcatggttaatgaaatgtcacatttgtatgtttcgctaatt
gggaaaatacctacgcagcctgatgctgaggacaaggctaccgaggcagaccaagcattg
gtttcacaaatattttccctgggccagaagcttgacgaagataattcgaaagacagtatc
ttcggtattgtggtgctgtattcggactacctagcccaccaggtggaccttatcgattca
ctgaaaatactaaaaatgattgtcgactgcttgtggcattaccttctggacccaaaccgg
caaatggaagccattagatgtttattagccttgaatagaggtatctctaaacaacatatc
gagggcgccctgaccagcgcgttcattagagaaaaggacattgccgcaaagcttactgtc
cttgacgcactgtggactaaattggagaacgatattggtatgatcagaaggccgctacag
cttatgtttgatgaattgttcgatgaacagcacctatcctatctgcacgtatccaagtgg
atagtatctgtcatcaatgcgaatgcctcgaataggctattccaagttctggcggataat
ctgctgtcgtttgattttttgatgaaagaaacactgactgaattggatgaccttgatctt
tttacctatcatgttcaaactgtgacaaatgttctgagaacagagcaatccgttcttctc
aaatccttcagtctcgaactgacctcattgcactcatttgaacagtggcgagaggaggat
gtctcaacatacaagggacttaccatcggaatccttcttagatttttaaacttggagaat
aatacgcatggtagaagtattagaagcgccctgattttattagatacactgattgacggt
actgaacagaattttaaggcaattgttaccagtttactgcagttgtcaaccaaatacatt
aagataaaagtccccgagtcggaactgatcattgtgtccctgttgagtattgtgtccaag
atattatctctgtcacacaagaatgacattaagttggatatatttgatgacaatagttcg
cacattaactacattgactttttagtgtcaagcattgcgaatattgagtcgcctttaact
gtctcctcttatgttcagttattgtccgaaagcatcatctacttccagcattccatcttc
aacatcattctaccactgtcttcctcactcacgcaatgtattgaaaggttattttatcaa
tctgaggataagggtaagaattacaagtctttctctttattaattgatgggctggaagaa
cttttggaagtatcacatgggtatctgatggcaggtgaaaacaatggctatctgaacggg
cccaattccaagaacgatttcctacagagcatggtgtcaaatgtattttcaaacgatcct
tcaaactctacctcgaagctccagggagagcgcgaggtggtattccagtcatacaagagg
gcgatcgactgcagttttggaatctggatatgggcacagaatatctcgaatagtagggct
ctaccacctgatcattgtgtgggggatccagaatacagcgagtctgcccaccaactgtca
tacaagtacaagttcaaaaccaagaaattgatcgacaagctgttcacacttgaaccatta
gagattctagaaaatttaatatcctatagaatggatgatttaaccataactctgacgcat
gttctcgatggtaacaggcctgttttgactttacctcacttgatgctgagcgttgtgagc
aagtgcaataaggcaaccacggtgacgttttcctctattgcttcgagaaaatcatctgac
cacctagtcactgccgccaagctagaaccaaaacaagtattggcctttattatcgaatat
gtgcgcagcctggagaacgcggccattgaggatttctacaacgacttccttgttttcata
aaagaggtttcacagaattattcgcaatatgagcagctcagttatcagcttctcatcctg
atagccatcatttctgaaaagattgcgcattcgcaatttgggcagcagaagcgagtacgt
aaagaggtcagcgatgtctttgtgaagtatttgacttcgacattggccgaggacatcgta
gcaaaaaacggcgtgtgcgaagccaactaccaagacattctattcatattggccaggctc
cagtatattgtaaatgaatcgcctcagggcgaccgcttcggggcttgtgtctccaccatc
gtctctcactgtgtgtcgccgctgttgaaacaagggaaactagaggtaagctcgcccggc
ttcatggagctgctcttggccattgcacctgttggggctaaggtacgcaactggaagacc
ctcctaaacgacatcttcacggataatacaaagctaagcatgtgcctcaaggaagacaga
tggaaccaggttatctacgaatggagccaatatccagacaatcaggacaaattgatcagt
gacctgctactagcaattggacaaaaagggaacgttatcacccccacaataaaccccttc
caaggctgggccgagtctgaggtcgacttgaagtgcaagcagatggtgaagctcgcatat
ctgctgcttatcgcgccgccggacacgtacttgttatacttcaagcaactaatgagccag
cttgaggactatctattcagcaccgacacgccgctgaaggcgaactgtttcatcctcctg
cgcgccgtatttttgtgcatcgaacagatgcacatcgcagactactggtccatgatcagc
cacggtttgcagacgggacttcaggcgttctacgagagcctccagatccaggaaccgatc
gacgcacacctggtgctgcacatgtgcaagtgcctcgacctgctgctcgtgctcaacatt
gaagacttcagcgccacgaacgagtggctgttcatcatcgacaccatcaactgcatctat
aaaacggacccattcatggctctcatcgacgagatcagcgaatgcaaagactacacgggc
agccacattgccgacatcgagctcgccgcgggtgatgcacgcctcccgcttctgtgtggt
atccgccgcgtcgacagccacctcgccctacgcaccttcttccacaacctcagctacagc
cactacgagacgtcgtacagcctcaaacccattgaccaggctgcctgttgcagagacgtc
gcggcagacatcctggccgctatatctaccaccaactaa

DBGET integrated database retrieval system