KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL190WHelp
Entry
AGOS_AGL190W      CDS       T00167                                 

Definition
(RefSeq) AGL190Wp
  KO
K13341  peroxin-7
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ago00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AGOS_AGL190W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 4622770
NCBI-ProteinID: NP_986477
UniProt: Q750X9
LinkDB All DBs
Position
VII:343645..344757
Genome map
AA seq 370 aa AA seqDB search
MLVYQMKGYSGYAVQYSPFFDNKLAVASGSNFGLVGNGRLFIMDLTAQGTMVESNSFLTK
DGLFDVAWNELHENQVLAAQGDGSLRLFDITLQQYPIALFQEHQREVFSCNWNLLHKDTF
VSSSWDGTVKVWTPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIY
QAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIAT
GGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMT
CRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATTGWDG
QVCAWYALAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttggtctaccaaatgaagggctacagcggctatgccgttcagtactcgccgttcttc
gacaacaagctggcagtggcatcaggatctaactttggactggtgggaaatggccgacta
ttcatcatggatctcacggcgcagggcacgatggtggagtccaactcatttctcaccaag
gatgggctgttcgacgtggcgtggaacgagctgcacgaaaaccaggtgctggcggcgcag
ggcgacgggtctctgcggttgttcgacatcacgctgcagcagtacccgatcgcgttgttc
caggagcaccagcgggaggtcttcagttgcaactggaacttgctgcataaggacacattt
gtgagctcgtcgtgggacggcacggtgaaggtgtggacaccggcgcggccacagagcatg
ctgacgctgctgcccgcgcccgcgaaccgcagcgtgatggtagagccaggcgcgcgcggc
ctaccgctctcgaaccagcagcagcacaaggacgctgccgacaacaaggactgcatatac
caggcgcaattctcgccgcacgacccgaatctcgtgatgagctgctccggtaactcctac
gtctcgcttttcgacctgcggcagcccgcggcgtcgaaccagcagcgcttcatcgcgcac
agtggtctagaagcgctctcctgcgacttcaacaaataccgcccgcatgtaatcgcgact
ggcggcgtcgacaagatggtcaaggtgtgggacctgcggatggtacggcagacacttaca
accagcaggactgcccctgtctccatcaacgaaatgcagggccactccttggctgtgcgc
aaagtcgtctggtccccgcaccactcgaacatcctcctctccacctcctacgacatgacc
tgccgagcctggcacgacctcgcggacggccccggtggccagcactcggggcgaaccaac
aacagcgacccgcagcgcggttgctcctatgtgttttccaagcactccgagttcgtcttc
ggtgcagactggagcctttggggccagccgggctacgtcgccaccaccggctgggacggc
caggtctgcgcgtggtacgcgctcgctaggtag

DBGET integrated database retrieval system