KEGG   Agrobacterium sp. H13-3: AGROH133_07013Help
Entry
AGROH133_07013    CDS       T01432                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:agr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGROH133_07013 (gst)
Enzymes [BR:agr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AGROH133_07013 (gst)
Transporters [BR:agr02000]
 Other Transporters
  Pores ion channels [TC:1]
   AGROH133_07013 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ADY64817
UniProt: F0L6Z0
LinkDB All DBs
Position
circular:1829001..1829627
Genome map
AA seq 208 aa AA seqDB search
MSELIFYTNPMSRGRIARWMLEEVGVPYKTEILGFSTSMKSPAYRLINPMAKVPAIKHGD
TIVTEAAAICAYLADAFPGANLAPTPKARGLYYRWMFFAAGPLEMTTSMKAMGFEVPQEK
LRMAGCGSYADAINTLERAVSENRFIAGDHFTAADVYVGAHVGWGLQFGTIEKRPAFTDY
MAHLTDRPAFKRATQLDEAAAKDMQAAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattgatcttctacaccaatcccatgtcgcgcggacgcattgcgcgatggatg
ctcgaggaagtgggcgttccctacaagacagagatactgggcttctcgacgtcgatgaaa
tcgccggcctatcggctgattaacccgatggccaaggtgcccgccatcaaacacggcgac
accattgtcaccgaagcggcagcgatctgcgcctatctggcggatgcctttccgggcgcc
aaccttgcgccgacgcccaaagcgcgcggactttattaccgctggatgttttttgctgcc
ggtccgttggaaatgacaaccagcatgaaggcgatgggtttcgaggtgccgcaggaaaag
ctgcgtatggctggctgcggcagctatgcggatgcgatcaacacgctcgaacgtgccgtc
agcgaaaaccgcttcattgccggcgatcacttcactgcggcggatgtctatgtaggtgcc
catgtcggctggggcctgcagttcggcacaatcgaaaaacgtccggccttcacggactat
atggcgcatctgaccgaccgccccgccttcaagcgggccacccagcttgatgaagcggca
gcgaaggatatgcaggcggcgggttga

DBGET integrated database retrieval system