KEGG   Agrobacterium sp. H13-3: AGROH133_07920Help
Entry
AGROH133_07920    CDS       T01432                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00240  Pyrimidine metabolism
agr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AGROH133_07920 (tdk)
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AGROH133_07920 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: ADY65185
UniProt: F0L8X6
LinkDB All DBs
Position
circular:2203151..2203732
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYAAMNAGKSTMLLQASYNYHERGMRTLIFTAAFDDRAGFGRVASRIGLSSDAR
TFDANTDIFSEVEALHAEAPVACVFIDEANFLSEHHVWQLAGIADRLNIPVMAYGLRTDF
QGKLFPASRELLAIADELREIRTICHCGRKATMVARFDNEGNVVKEGAQIDVGGNEKYVS
FCRRHWVETVKGD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaattatgcggcgatgaacgccggcaagtcgaccatgttgtta
caggcatcctataattatcacgagcgcggcatgcgcacgttgattttcacggccgccttt
gacgaccgggccggcttcggccgggtcgcgtcgcgcatcggcctgtcgtccgacgcacgg
accttcgacgcaaacaccgatatcttctccgaagtggaggccctgcatgccgaagcgccc
gttgcctgcgttttcatcgatgaagccaacttcctgtccgaacaccatgtctggcagctt
gccggtattgccgaccggttgaacattccggtgatggcctacggcctgcgcacggatttt
cagggcaagcttttcccggcctccagggaactgctcgccattgccgacgagcttcgcgaa
atccgcaccatctgccattgcggccgcaaggcgacgatggtcgcccgtttcgacaatgaa
ggaaatgtggtcaaggaaggcgcgcagatcgatgtcggcggcaacgaaaaatacgtctcc
ttctgccgccgccactgggtcgaaacggtcaagggcgactga

DBGET integrated database retrieval system