KEGG   Agrobacterium sp. H13-3: AGROH133_10254Help
Entry
AGROH133_10254    CDS       T01432                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00500  Starch and sucrose metabolism
agr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGROH133_10254
Enzymes [BR:agr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AGROH133_10254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ADY66147
UniProt: F0L9M5
LinkDB All DBs
Position
linear:complement(457578..459983)
Genome map
AA seq 801 aa AA seqDB search
MMRTGLDFAPGAPGIEARWTSSAKNGVGTALSEASPIWFTLSHGILNEVYYPRIDSACTR
DLGFVVTGPEGYFSEEKRDCVSVTRPFKSGIPAFHITNTATDGSFRIEKQVISDPARASV
LQQLSFIPLKGQISDYRVTALLAPHLVNAGNLNSAWIGDYEGHQVLFATGRSRYLALVCD
LPWRAVSAGFVGVSDGWQQLHRHGRIVEEYQRADDGNVSLAGEIDFSDVNGAATLALGFG
ETEYEAAAAAVYSLKHGFERAHEAYVANWRNWQDRLETLDRDTHHGINSYRVSTAVLAAH
RAADRPGAVVASLSIPWGASKSDDDLGGYHLVWPRDLVEAAGGFLAAGDHHEALAILNYL
RQVQQPSGRWPQNLWLDGKPYWPGVQMDECAFPILLADMLHRHGHLDHATRADFMPMIHR
AAAYILANGPTTGEDRWEEDAGYSPFTLAVEIAALLAAADLIDMDGDAAEAVHLRETADC
WNEQIEQWTFAGDETFCAALGISGHYVRIASPDATDVARPFGDTPIRNQTPDRSTLPTSD
VISPDALALVRFGLRAPDDPHILATIKAIDHCLRADLPQGPVWYRYTGDGYGEHADGAAF
DGTGQGRPWPLLTGERAHYELAAGRREVAEALLVTLEKSAGGNGLFPEQLWDQPDVPEYE
LFYGQPSGSAMPLVWAHAEHIKLLRSLADGSVFDVPPQGVERYILNKTPSHLRIWCFNNK
IAGMPAGKMLRLELTDDAVVHWSADGWVTTSDTRTSASGLGTYFVDLPVQDMAAGDAIVF
TFFWPNTGNWENQDFTVRLGE
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcaccggactggattttgcaccgggcgcgcctggcatagaagcgcgctggacg
tcgagcgccaaaaacggggtcggcactgcgctgtcggaagcatcgcctatctggttcacg
ctcagccacggcattctgaacgaggtctattatccgaggatagacagtgcctgcacccgc
gatctcggttttgttgtcactgggcctgagggttacttttcggaagaaaaacgcgactgc
gtatccgtcacccgcccttttaaaagtggaattccggcatttcacattaccaatacggcg
acggatggctcgttcagaattgagaaacaggtgatcagcgatcccgcgcgggccagtgtt
cttcagcagctttcgttcattcccctgaagggacaaatttcggattatcgcgtgactgcg
ctgctggcacctcatctcgtcaatgcaggtaatcttaactcggcttggattggcgactat
gagggacatcaggtcctcttcgcgaccggccgttcacgatatcttgcgcttgtctgcgat
ctgccctggcgggcagtcagcgccggtttcgtgggtgtttccgatggttggcagcagttg
catcggcacggacgcatcgttgaagagtaccagcgagccgatgacggaaatgtctcgctg
gcaggtgagatcgacttcagtgatgtcaatggcgcggcaacattggcgctcggctttggc
gagacggaatatgaagcggctgcggcggccgtttatagtctgaagcatggctttgaacgg
gcgcacgaggcctacgttgccaactggcgcaactggcaagaccggctggaaacgctcgac
cgcgatacgcatcacggcatcaattcctatcgggtgtcgacagcagtgctcgccgcacat
cgtgccgccgaccgaccgggcgctgttgttgcaagcctgtcgatcccttggggagcatcg
aagagcgatgacgatctcggtggttatcacctggtctggccgcgcgacctggtggaagcg
gccggcggatttctggcggccggcgatcaccacgaggcgctggcgatcctcaattatctt
cgtcaggtacagcagccatcgggccgctggccgcaaaatctctggctggatggcaaaccc
tattggccaggcgtccagatggatgaatgcgcctttccgatcctgctggcggatatgctg
catcgacatggtcacctggatcatgccacgcgggcggattttatgccgatgatccaccgc
gccgcggcctatattctggcaaacggcccgacgaccggtgaggacaggtgggaagaggat
gccggctacagtcccttcacccttgccgtcgagatcgctgcgctgcttgccgctgccgac
cttatcgatatggacggtgatgctgccgaagccgtgcatctacgggaaacggctgattgc
tggaacgagcagatcgaacaatggacctttgccggtgacgagacattctgcgccgcgctt
ggcatttccggccactatgttcgcatcgcttcgcctgacgcgaccgacgtagctcgacca
ttcggcgatacgcccatccgcaaccagacgccggaccgttccacgctgccgaccagcgac
gtcatcagtcccgatgcgcttgcccttgttcgcttcggcctgcgcgcgcctgacgatccg
catattctcgcgacgatcaaagcaatcgaccattgcctgcgtgccgatctgccgcagggg
cctgtatggtatagatatacgggcgatggatatggtgagcacgccgatggagcagcattc
gacggcaccgggcaggggcggccatggccgcttttaaccggcgaacgcgcccattacgag
cttgctgcgggaaggcgggaggtggccgaagcgctgctggtaacgctggagaaatcggcc
ggtgggaacggccttttccccgagcagctctgggaccagcccgacgtccccgaatacgag
cttttctacggccagccctcaggaagtgcgatgccgctggtctgggcgcatgctgaacat
atcaaacttctgcggtcgcttgccgatggttccgttttcgacgtgccgccgcagggtgtg
gagcgctacatcctcaacaagacgccgtcgcaccttcggatctggtgtttcaataacaag
attgccgggatgccggccggcaagatgttgcggctcgaactgacggatgatgctgtcgtg
cactggagtgcggatggctgggtgacgaccagcgacaccagaacgagtgcttccggcctt
ggcacatatttcgtcgacttgcccgttcaggatatggcggcgggcgacgcaatcgttttt
actttcttttggccaaacacagggaattgggaaaaccaggatttcaccgttcgcctcggc
gaatga

DBGET integrated database retrieval system