KEGG   Agrobacterium sp. H13-3: AGROH133_11117Help
Entry
AGROH133_11117    CDS       T01432                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00473  D-Alanine metabolism
agr01100  Metabolic pathways
agr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:agr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AGROH133_11117
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AGROH133_11117
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:agr01011]
    AGROH133_11117
Enzymes [BR:agr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AGROH133_11117
Peptidoglycan biosynthesis and degradation proteins [BR:agr01011]
 Precursor biosynthesis
  Racemase
   AGROH133_11117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADY66457
UniProt: F0LBE9
LinkDB All DBs
Position
linear:791203..792369
Genome map
AA seq 388 aa AA seqDB search
MDMQISRQQAAGGASGHLTIDLGALRDNYLALAAMAPTSQTAAVVKADAYGLGADIVSQV
LFDAGCRNFFVAHIDEALALRLRLSAEARIFVLNGLQPGNEASCAAMAVTPVLNSLEQIA
QWAAHAKNLGKTLPAAVQIDTGMCRLGLSPEELEVLASRPQLLDDIDVAFVMSHLACADE
PDHLSNAAQLSVMRKAAVAFPDVSVCFSNSGGIFLGNDYHNSLLRPGIALYGGAPSVTRP
NPMKPVVRLDVAVIQTRDVPAGSLVGYGGSFEAAGPTRLATIAAGYADGLPRSLSNRGAA
WYNGVRLPIAGRVSMDSIILDISALPLGTLTQGSFVQMIGPDQTLEDIAEDAGTIAYEIL
TGLGRRYRRNYIQPGETPAVASTSVSHK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcagatcagccgccagcaggcagcgggtggtgcaagcggccatctgaccatc
gatcttggcgcattgcgcgataattatctcgcgcttgcggcaatggcacccacatcgcag
acggcagcggtcgtcaaggctgacgcatacggcctcggcgcggatatcgtctcgcaggtg
ctgtttgacgcgggctgccggaatttcttcgtcgcccatatcgatgaagcgctggcgctc
cggctgcgtctttcagcggaagcgcggattttcgtcctcaacgggcttcaacccggtaac
gaagcctcctgcgcagccatggccgtcacaccggttctgaattcgctcgagcagatcgcc
caatgggcggcccacgccaaaaatcttggcaagacgttacccgccgcagtgcagatcgat
accggcatgtgccgtctcggcctctctcccgaagagcttgaagtcctcgcctcccggccg
caactgcttgatgacatcgacgtcgccttcgtgatgagccacctcgcctgcgccgacgag
ccggatcacctctccaatgccgcccaactctctgtgatgcgaaaagccgctgtcgctttt
cctgatgtatccgtctgtttttccaattccggcggcatctttctgggcaacgactatcac
aactccctgctacgccccggcattgcgctttatggcggcgcgccctccgttacccgtccc
aacccgatgaaaccggttgtccggcttgatgtcgccgttattcagacccgcgacgttccc
gccggatcgctggtcggttatggcggctctttcgaagcagccgggccgacgcggcttgcg
acgatcgcggctggttatgccgatggcctgccgcgatcgctcagcaatcgcggtgcggca
tggtacaatggcgttcgcctgcccattgctggtcgagtttcaatggacagcatcattctc
gacatatccgccctgcccttgggaacattgacgcaaggcagcttcgtgcagatgatcggg
cctgaccagacgctggaagacattgccgaggatgcgggcacgatcgcctatgaaatcctg
accggcctcggacgccgttaccgccgcaattatattcagccgggcgaaaccccggccgtc
gcttcaacatctgtcagccataagtga

DBGET integrated database retrieval system