KEGG   Agrobacterium sp. H13-3: AGROH133_11872Help
Entry
AGROH133_11872    CDS       T01432                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00564  Glycerophospholipid metabolism
agr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AGROH133_11872
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AGROH133_11872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C STPPase_N FAD_oxidored NAD_binding_8 FAD_binding_2 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADY66743
UniProt: F0LCD3
LinkDB All DBs
Position
linear:complement(1112841..1114385)
Genome map
AA seq 514 aa AA seqDB search
MSGENIFDLFVIGGGVNGCGIARDAVGRGYSVALAEKGDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREILWAMAPHVIWPMRFVLPLQKGGVRPAWMVRLGLFLYDNLGGRKL
LPPTRTVDLRQDPAGKPLKPVFAKAFEYSDGWVDDARFVVLNARDAADRGATIMNRTRVV
SARREGGVWLIETLDEKTGRSATHRARMLVNAAGPWVDNVLSGVFGRNDVHNVRLVQGSH
IIVRRKFSDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYKGDPAKVRISEEEISYLC
NAASEYFSEPVKPDDIVWTYSGVRPLFDDGASKAQEATRDYVLKVEEAEGEAPLLNIFGG
KLTTYRRLAEHALEKIGAAIGEKGKPWTAGSYLPGGDFGVERYDAQVRALVSRYPFLDGR
HAERLIRNYGTKAAELLGVATDVSGLGRHFGGTLYECEVRWLLEHEWAFAAEDILWRRTK
QGLRLSKDEAAALDEFISTLTGVKEKGEAVTEQA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgaaaacatattcgatctttttgtcatcggcggtggcgtgaatggttgcggc
attgcccgcgatgccgtgggtaggggctattccgtggcgcttgcggaaaagggcgatttt
gcctccggtacgtcttcggcagccaccaagctcatccatggcggcctgcgttatctcgaa
cattatgagtttcgtctggtgcgcgaagccttgatggagcgtgaaattctgtgggccatg
gccccgcacgtcatctggcccatgcgcttcgtcctgccgctccagaaaggcggcgtgcgt
ccggcatggatggtccggcttggcctctttctttatgacaacctcggcggccgcaagctt
ttgccgccgacgcgcacggtcgatcttcggcaagacccggcaggcaaacctctgaagccg
gtctttgccaaggctttcgaatattccgacggctgggtggacgatgcccgtttcgtggtt
ctgaatgcgcgtgacgcggcggatcgcggtgcgacgatcatgaaccgcacgcgggtcgtt
tccgcacggcgcgaaggcggcgtgtggcttatcgagacgctggacgaaaagaccggccgt
tcagccacgcacagagcgcgcatgctggtgaatgccgctggcccatgggtggataacgtg
ctgtccggcgtgttcggccgcaacgatgtgcacaatgttcgtctcgtgcagggcagccac
atcatcgtgcgcaggaagttttccgatccgcgcgcctatttcttccagaacccggacaac
cgcatcatcttcgccattccctatgagcaagattttacgctgatcggcaccacggaccgc
gattacaagggcgatccggccaaggtgcgcatctctgaggaagagatttcctatctctgc
aatgccgccagcgaatatttcagcgagccggtgaagcccgatgatatcgtctggacctat
tccggcgtgcgcccgcttttcgatgatggcgcttcaaaggcgcaggaagccacacgcgac
tatgtgctgaaggttgaagaggcagagggcgaagcgccgctactcaatatcttcggcggc
aagctgaccacctaccggcggctggcggaacatgctctggaaaagatcggcgcagccatc
ggagaaaagggcaagccctggacggcgggctcgtatctgccgggcggtgacttcggggtg
gagagatatgacgcccaggtgagggcgcttgtctcccgttatccattccttgatggacgc
catgccgagcggctcatcagaaactacggcacgaaggctgcggaactgctcggtgtcgcc
accgatgtttccggcctcggccggcatttcggcggtacactttacgaatgcgaagtgcgc
tggctgttggaacacgaatgggcctttgcagccgaggatattctctggcggcgcactaaa
cagggcctgcggttgagcaaggacgaggctgccgctctggatgaattcatttccacgctg
actggtgtcaaggaaaagggcgaagccgtgacggagcaggcctga

DBGET integrated database retrieval system